ARID3B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ARID3B
Ідентифікатори
Символи ARID3B, BDP, DRIL2, AT-rich interaction domain 3B
Зовнішні ІД OMIM: 612457 MGI: 1930768 HomoloGene: 4721 GeneCards: ARID3B
Шаблон експресії
PBB GE ARID3B 218964 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001307939
NM_006465
NM_019689
RefSeq (білок)
NP_001294868
NP_006456
NP_062663
Локус (UCSC) Хр. 15: 74.54 – 74.6 Mb Хр. 9: 57.79 – 57.84 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ARID3B (англ. AT-rich interaction domain 3B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 561 амінокислот, а молекулярна маса — 60 637[4].

Послідовність амінокислот
1020304050
MEPLQQQQQQQQQQQKQPHLAPLQMDAREKQGQQMREAQFLYAQKLVTQP
TLLSATAGRPSGSTPLGPLARVPPTAAVAQVFERGNMNSEPEEEDGGLED
EDGDDEVAEVAEKETQAASKYFHVQKVARQDPRVAPMSNLLPAPGLPPHG
QQAKEDHTKDASKASPSVSTAGQPNWNLDEQLKQNGGLAWSDDADGGRGR
EISRDFAKLYELDGDPERKEFLDDLFVFMQKRGTPINRIPIMAKQILDLY
MLYKLVTEKGGLVEIINKKIWREITKGLNLPTSITSAAFTLRTQYMKYLY
AYECEKKALSSPAELQAAIDGNRREGRRPSYSSSLFGYSPAAATAAAAAG
APALLSPPKIRFPILGLGSSSGTNTSSPRISPATTLRKGDGAPVTTVPVP
NRLAVPVTLASQQAGTRTAALEQLRERLESGEPAEKKASRLSEEEQRLVQ
QAFQRNFFSMARQLPMKIRINGRAEDRAEASAAALNLTTSSIGSINMSVD
IDGTTYAGVLFAQKPVVHLITGSAPQSLGSSASSSSSSHCSPSPTSSRGT
PSAEPSTSWSL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kobayashi K., Era T., Takebe A., Jakt L.M., Nishikawa S. (2006). ARID3B induces malignant transformation of mouse embryonic fibroblasts and is strongly associated with malignant neuroblastoma.. Cancer Res. 66: 8331 — 8336.  PubMed DOI:10.1158/0008-5472.CAN-06-0756
  • Kim D., Probst L., Das C., Tucker P.W. (2007). REKLES is an ARID3-restricted multifunctional domain.. J. Biol. Chem. 282: 15768 — 15777.  PubMed DOI:10.1074/jbc.M700397200
  • Numata S., Claudio P.P., Dean C., Giordano A., Croce C.M. (1999). Bdp, a new member of a family of DNA-binding proteins, associates with the retinoblastoma gene product.. Cancer Res. 59: 3741 — 3747.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:14350 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q8IVW6 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]