TEAD1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TEAD1
Protein TEAD1 PDB 2hzd.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TEAD1, AA, NTEF-1, REF1, TCF-13, TCF13, TEAD-1, TEF-1, TEA domain transcription factor 1
Зовнішні ІД OMIM: 189967 MGI: 101876 HomoloGene: 2418 GeneCards: TEAD1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_021961
NM_001166584
NM_001166585
NM_009346
NM_175559
RefSeq (білок)
NP_068780
NP_001160056
NP_001160057
NP_033372
Локус (UCSC) Хр. 11: 12.67 – 12.94 Mb Хр. 7: 112.68 – 112.91 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TEAD1 (англ. TEA domain transcription factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 426 амінокислот, а молекулярна маса — 47 946[4].

Послідовність амінокислот
1020304050
MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIY
PPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARR
KSRDFHSKLKDQTAKDKALQHMAAMSSAQIVSATAIHNKLGLPGIPRPTF
PGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPA
PSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYS
DPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD
DAGAFYGVTSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFV
YRINRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETL
LCMACVFEVSNSEHGAQHHIYRLVKD

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Xiao J.H., Davidson I., Matthes H., Garnier J.-M., Chambon P. (1991). Cloning, expression, and transcriptional properties of the human enhancer factor TEF-1.. Cell 65: 551 — 568.  PubMed DOI:10.1016/0092-8674(91)90088-G
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Buerglin T.R. (1991). The TEA domain: a novel, highly conserved DNA-binding motif.. Cell 66: 11 — 12.  PubMed DOI:10.1016/0092-8674(91)90132-I

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11714 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, P28347 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]