ARID3A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ARID3A
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ARID3A, BRIGHT, DRIL1, DRIL3, E2FBP1, AT-rich interaction domain 3A
Зовнішні ІД OMIM: 603265 MGI: 1328360 HomoloGene: 124247 GeneCards: ARID3A
Шаблон експресії
PBB GE ARID3A 205865 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005224
NM_001288625
NM_001288626
NM_007880
RefSeq (білок)
NP_005215
NP_001275554
NP_001275555
NP_031906
Локус (UCSC) Хр. 19: 0.93 – 0.98 Mb Хр. 10: 79.93 – 79.96 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ARID3A (англ. AT-rich interaction domain 3A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 593 амінокислот, а молекулярна маса — 62 889[4].

Послідовність амінокислот
1020304050
MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPPGRARAAPDEDREPE
SARMQRAQMAALAAMRAAAAGLGHPASPGGSEDGPPGSEEEDAAREGTPG
SPGRGREGPGEEHFEDMASDEDMKPKWEEEEMEEDLGEDEEEEEEDYEDE
EEEEDEEGLGPPGPASLGTTALFPRKAQPPQAFRGDGVPRVLGGQERPGP
GPAHPGGAAHVAPQLQPPDHGDWTYEEQFKQLYELDGDPKRKEFLDDLFS
FMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKG
LNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNELQAAIDSNRREGR
RQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKE
EDSAIPITVPGRLPVSLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLR
EKLESAEPPEKKMALVADEQQRLMQRALQQNFLAMAAQLPMSIRINSQAS
ESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPAPTPTSAPNKG
GGGGGGSSSNAGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kim D., Probst L., Das C., Tucker P.W. (2007). REKLES is an ARID3-restricted multifunctional domain.. J. Biol. Chem. 282: 15768 — 15777.  PubMed DOI:10.1074/jbc.M700397200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3031 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q99856 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]