VDR

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
VDR
Ідентифікатори
Символи VDRvitamin D3 receptorvitamin D (1,25- dihydroxyvitamin D3) receptorprotein phosphatase 1regulatory subunit 163vitamin D nuclear receptor variant 1Calcitriol Receptor1,25-dihydroxyvitamin D3 receptornuclear receptor subfamily 1 group I member 1Calcitriol Receptors
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE VDR 204254 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

VDR (англ. Vitamin D receptor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 427 амінокислот, а молекулярна маса — 48 289[2].

Послідовність амінокислот
1020304050
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRR
SMKRKALFTCPFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEV
QRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDF
CQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSS
SFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPG
FRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDV
TKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAA
LIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQ
YRCLSFQPECSMKLTPLVLEVFGNEIS

Кодований геном білок за функцією належить до рецепторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Goto H., Chen K.S., Prahl J.M., Deluca H.F. (1992). A single receptor identical with that from intestine/T47D cells mediates the action of 1,25-dihydroxyvitamin D-3 in HL-60 cells.. Biochim. Biophys. Acta 1132: 103 — 108.  PubMed DOI:10.1016/0167-4781(92)90063-6
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Mahajan M.A., Samuels H.H. (2000). A new family of nuclear receptor coregulators that integrates nuclear receptor signaling through CBP.. Mol. Cell. Biol. 20: 5048 — 5063.  PubMed DOI:10.1128/MCB.20.14.5048-5063.2000
  • Rochel N., Wurtz J.-M., Mitschler A., Klaholz B., Moras D. (2000). The crystal structure of the nuclear receptor for vitamin D bound to its natural ligand.. Mol. Cell 5: 173 — 179.  PubMed DOI:10.1016/S1097-2765(00)80413-X
  • Tocchini-Valentini G., Rochel N., Wurtz J.-M., Mitschler A., Moras D. (2001). Crystal structures of the vitamin D receptor complexed to superagonist 20-epi ligands.. Proc. Natl. Acad. Sci. U.S.A. 98: 5491 — 5496.  PubMed DOI:10.1073/pnas.091018698
  • Shaffer P.L., Gewirth D.T. (2002). Structural basis of VDR-DNA interactions on direct repeat response elements.. EMBO J. 21: 2242 — 2252.  PubMed DOI:10.1093/emboj/21.9.2242

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:12679 (англ.). Процитовано 11 вересня 2017. 
  2. UniProt, P11473 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]