HMGN2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HMGN2
Ідентифікатори
Символи HMGN2, HMG17, high mobility group nucleosomal binding domain 2
Зовнішні ІД OMIM: 163910 HomoloGene: 136792 GeneCards: HMGN2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005517
н/д
RefSeq (білок)
NP_005508
н/д
Локус (UCSC) Хр. 1: 26.47 – 26.48 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

HMGN2 (англ. High mobility group nucleosomal binding domain 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [2] Довжина поліпептидного ланцюга білка становить 90 амінокислот, а молекулярна маса — 9 393[3].

Послідовність амінокислот
1020304050
MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGE
KVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як поліморфізм, ацетиляція. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Landsman D., McBride O.W., Bustin M. (1989). Human non-histone chromosomal protein HMG-17: identification, characterization, chromosome localization and RFLPs of a functional gene from the large multigene family.. Nucleic Acids Res. 17: 2301 — 2314.  PubMed DOI:10.1093/nar/17.6.2301
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Louie D.F., Gloor K.K., Galasinski S.C., Resing K.A., Ahn N.G. (2000). Phosphorylation and subcellular redistribution of high mobility group proteins 14 and 17, analyzed by mass spectrometry.. Protein Sci. 9: 170 — 179.  PubMed DOI:10.1110/ps.9.1.170
  • Landsman D., Soares N., Gonzalez F.J., Bustin M. (1986). Chromosomal protein HMG-17. Complete human cDNA sequence and evidence for a multigene family.. J. Biol. Chem. 261: 7479 — 7484.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:4986 (англ.). Процитовано 25 серпня 2017. 
  3. UniProt, P05204 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]