PHF20

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PHF20
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PHF20, C20orf104, GLEA2, HCA58, NZF, TDRD20A, TZP, PHD finger protein 20
Зовнішні ІД OMIM: 610335 MGI: 2444148 HomoloGene: 9507 GeneCards: PHF20
Шаблон експресії
PBB GE PHF20 209422 at fs.png

PBB GE PHF20 209423 s at fs.png

PBB GE PHF20 206567 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_016436
NM_172674
RefSeq (білок)
NP_057520
NP_766262
Локус (UCSC) Хр. 20: 35.77 – 35.95 Mb Хр. 2: 156.2 – 156.31 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PHF20 (англ. PHD finger protein 20) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 012 амінокислот, а молекулярна маса — 115 386[4].

Послідовність амінокислот
1020304050
MTKHPPNRRGISFEVGAQLEARDRLKNWYPAHIEDIDYEEGKVLIHFKRW
NHRYDEWFCWDSPYLRPLEKIQLRKEGLHEEDGSSEFQINEQVLACWSDC
RFYPAKVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFSKDQNIVGNARPKE
TDHKSLSSSPDKREKFKEQRKATVNVKKDKEDKPLKTEKRPKQPDKEGKL
ICSEKGKVSEKSLPKNEKEDKENISENDREYSGDAQVDKKPENDIVKSPQ
ENLREPKRKRGRPPSIAPTAVDSNSQTLQPITLELRRRKISKGCEVPLKR
PRLDKNSSQEKSKNYSENTDKDLSRRRSSRLSTNGTHEILDPDLVVSDLV
DTDPLQDTLSSTKESEEGQLKSALEAGQVSSALTCHSFGDGSGAAGLELN
CPSMGENTMKTEPTSPLVELQEISTVEVTNTFKKTDDFGSSNAPAVDLDH
KFRCKVVDCLKFFRKAKLLHYHMKYFHGMEKSLEPEESPGKRHVQTRGPS
ASDKPSQETLTRKRVSASSPTTKDKEKNKEKKFKEFVRVKPKKKKKKKKK
TKPECPCSEEISDTSQEPSPPKAFAVTRCGSSHKPGVHMSPQLHGPESGH
HKGKVKALEEDNLSESSSESFLWSDDEYGQDVDVTTNPDEELDGDDRYDF
EVVRCICEVQEENDFMIQCEECQCWQHGVCMGLLEENVPEKYTCYVCQDP
PGQRPGFKYWYDKEWLSRGHMHGLAFLEENYSHQNAKKIVATHQLLGDVQ
RVIEVLHGLQLKMSILQSREHPDLPLWCQPWKQHSGEGRSHFRNIPVTDT
RSKEEAPSYRTLNGAVEKPRPLALPLPRSVEESYITSEHCYQKPRAYYPA
VEQKLVVETRGSALDDAVNPLHENGDDSLSPRLGWPLDQDRSKGDSDPKP
GSPKVKEYVSKKALPEEAPARKLLDRGGEGLLSSQHQWQFNLLTHVESLQ
DEVTHRMDSIEKELDVLESWLDYTGELEPPEPLARLPQLKHCIKQLLMDL
GKVQQIALCCST

Кодований геном білок за функціями належить до регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:16098 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9BVI0 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]