TFAP2A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TFAP2A
Ідентифікатори
Символи TFAP2A, AP-2, AP-2alpha, AP2TF, BOFS, TFAP2, transcription factor AP-2 alpha
Зовнішні ІД OMIM: 107580 MGI: 104671 HomoloGene: 2421 GeneCards: TFAP2A
Пов'язані генетичні захворювання
бічний аміотрофічний склероз, branchiooculofacial syndrome[1]
Шаблон експресії
PBB GE TFAP2A 204653 at fs.png

PBB GE TFAP2A 210669 at fs.png

PBB GE TFAP2A 204654 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001032280
NM_001042425
NM_003220
NM_001372066
NM_001122948
NM_001301674
NM_011547
RefSeq (білок)
NP_001027451
NP_001035890
NP_003211
NP_001358995
NP_001116420
NP_001288603
NP_035677
Локус (UCSC) Хр. 6: 10.39 – 10.42 Mb Хр. 13: 40.72 – 40.74 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TFAP2A (англ. Transcription factor AP-2 alpha) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 437 амінокислот, а молекулярна маса — 48 062[5].

Послідовність амінокислот
1020304050
MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPN
ADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQR
QSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIH
SLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNL
FGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLG
GVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHL
ARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVTRKNMLLATKQICKEFTD
LLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQN
YLTEALKAMDKMYLSNNPNSHTDNNAKSSDKEEKHRK

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Williams T., Admon A., Luescher B., Tjian R. (1988). Cloning and expression of AP-2, a cell-type-specific transcription factor that activates inducible enhancer elements.. Genes Dev. 2: 1557 — 1569.  PubMed DOI:10.1101/gad.2.12a.1557
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Williams T., Tjian R. (1991). Characterization of a dimerization motif in AP-2 and its function in heterologous DNA-binding proteins.. Science 251: 1067 — 1071.  PubMed DOI:10.1126/science.1998122
  • Williams T., Tjian R. (1991). Analysis of the DNA-binding and activation properties of the human transcription factor AP-2.. Genes Dev. 5: 670 — 682.  PubMed DOI:10.1101/gad.5.4.670
  • Garcia M.A., Campillos M., Marina A., Valdivieso F., Vazquez J. (1999). Transcription factor AP-2 activity is modulated by protein kinase A-mediated phosphorylation.. FEBS Lett. 444: 27 — 31.  PubMed DOI:10.1016/S0014-5793(99)00021-6
  • Eloranta J.J., Hurst H.C. (2002). Transcription factor AP-2 interacts with the SUMO-conjugating enzyme UBC9 and is sumolated in vivo.. J. Biol. Chem. 277: 30798 — 30804.  PubMed DOI:10.1074/jbc.M202780200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]