ING5

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ING5
Protein ING5 PDB 1wen.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ING5, p28inhibitor of growth family member 5
Зовнішні ІД OMIM: 608525 MGI: 1922816 HomoloGene: 90955 GeneCards: ING5
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_032329
NM_001330161
NM_001330162
NM_025454
RefSeq (білок)
NP_001317090
NP_001317091
NP_115705
NP_079730
Локус (UCSC) Хр. 2: 241.69 – 241.73 Mb Хр. 1: 93.8 – 93.82 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ING5 (англ. Inhibitor of growth family member 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 240 амінокислот, а молекулярна маса — 27 751[4].

Послідовність амінокислот
1020304050
MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYI
STVKTLSPDQRVERLQKIQNAYSKCKEYSDDKVQLAMQTYEMVDKHIRRL
DADLARFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGSRGRGRRTSEE
DTPKKKKHKGGSEFTDTILSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMI
GCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK

Кодований геном білок за функціями належить до активаторів, регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:19421 (англ.). Процитовано 29 серпня 2017. 
  4. UniProt, Q8WYH8 (англ.). Процитовано 29 серпня 2017. 

Див. також[ред. | ред. код]