ZNF365

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF365
Ідентифікатори
Символи ZNF365, Su48, UAN, ZNF365D, zinc finger protein 365
Зовнішні ІД OMIM: 607818 MGI: 2143676 HomoloGene: 8975 GeneCards: ZNF365
Пов'язані генетичні захворювання
Нарколепсія, рак молочної залози, atopic dermatitis[1]
Шаблон експресії
PBB GE ZNF365 206448 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_014951
NM_199450
NM_199451
NM_199452
NM_178679
RefSeq (білок)
NP_848794
Локус (UCSC) н/д Хр. 10: 67.89 – 67.91 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF365 (англ. Zinc finger protein 365) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 216 амінокислот, а молекулярна маса — 24 036[5].

Послідовність амінокислот
1020304050
MSALGQITITVSRCWNTERNQTDKNPCLHGAYLQLRETVKNKSTHLKKPL
MKQAPPWKDHLTFQPLHPAERKTQVWRWQSGNSSDLETTSSASPWPTGSN
RDVVLNTLAESCCGLSELITAPPYAGVSIQGFSQIWVLFPFCGGTFHHNE
KDVLGLQDFERESVSTSQSRNISLLTLGQLQNCVIGKLTIIDLLTEHLLG
VRHGVICFPWGLPSSS

Задіяний у такому біологічному процесі, як альтернативний сплайсинг.

Література[ред. | ред. код]

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]