HMGB1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HMGB1
Ідентифікатори
Символи Amphoterinhigh-mobility group (nonhistone chromosomal) protein 1HMGB1Sulfoglucuronyl carbohydrate binding proteinHMG-1High mobility group protein 1high mobility group protein B1
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

HMGB1 (англ. High mobility group box 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 13-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 215 амінокислот, а молекулярна маса — 24 894[2].

Послідовність амінокислот
1020304050
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWK
TMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS
AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK
LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE
EDEEDEDEEEDDDDE

Задіяний у таких біологічних процесах як адаптивний імунітет, імунітет, вроджений імунітет, запальна відповідь, пошкодження ДНК, репарація ДНК, хемотаксис, рекомбінація ДНК, автофагія. Білок має сайт для зв'язування з ДНК. Локалізований у клітинній мембрані, цитоплазмі, ядрі, мембрані, хромосомах, ендосомах. Також секретований назовні.

Література[ред. | ред. код]

  • Wen L., Huang J.K., Johnson B.H., Reeck G.R. (1989). A human placental cDNA clone that encodes nonhistone chromosomal protein HMG-1.. Nucleic Acids Res. 17: 1197 — 1214.  PubMed DOI:10.1093/nar/17.3.1197
  • Ferrari S., Finelli P., Rocchi M., Bianchi M.E. (1996). The active gene that encodes human high mobility group 1 protein (HMG1) contains introns and maps to chromosome 13.. Genomics 35: 367 — 371.  PubMed DOI:10.1006/geno.1996.0369
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Yuan F., Gu L., Guo S., Wang C., Li G.M. (2004). Evidence for involvement of HMGB1 protein in human DNA mismatch repair.. J. Biol. Chem. 279: 20935 — 20940.  PubMed DOI:10.1074/jbc.M401931200
  • DeMarco R.A., Fink M.P., Lotze M.T. (2005). Monocytes promote natural killer cell interferon gamma production in response to the endogenous danger signal HMGB1.. Mol. Immunol. 42: 433 — 444.  PubMed DOI:10.1016/j.molimm.2004.07.023
  • Bell C.W., Jiang W., Reich C.F., Pisetsky D.S. (2006). The extracellular release of HMGB1 during apoptotic cell death.. Am. J. Physiol. 291: C1318 — C1325.  PubMed DOI:10.1152/ajpcell.00616.2005

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:4983 (англ.). Процитовано 27 лютого 2017. 
  2. UniProt, P09429 (англ.). Процитовано 27 лютого 2017. 

Див. також[ред. | ред. код]