KLF2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KLF2
Ідентифікатори
Символи KLF2, LKLF, Kruppel-like factor 2, Kruppel like factor 2
Зовнішні ІД OMIM: 602016 MGI: 1342772 HomoloGene: 133978 GeneCards: KLF2
Шаблон експресії
PBB GE KLF2 219371 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_016270
NM_008452
RefSeq (білок)
NP_057354
NP_032478
Локус (UCSC) Хр. 19: 16.32 – 16.33 Mb Хр. 8: 72.32 – 72.32 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KLF2 (англ. Kruppel like factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 355 амінокислот, а молекулярна маса — 37 420[4].

Послідовність амінокислот
1020304050
MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILS
MGLDGLGAEAAPEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPEL
DAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGLTRGPRGLKRE
GAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGP
GFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPL
ELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEK
PYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH
MKRHM

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Kozyrev S.V., Hansen L.L., Poltaraus A.B., Domninsky D.A., Kisselev L.L. (1999). Structure of the human CpG-island-containing lung Kruppel-like factor (LKLF) gene and its location in chromosome 19p13.11-13 locus.. FEBS Lett. 448: 149 — 152.  PubMed DOI:10.1016/S0014-5793(99)00348-8
  • Wani M.A., Conkright M.D., Jeffries S., Hughes M.J., Lingrel J.B. (1999). cDNA isolation, genomic structure, regulation, and chromosomal localization of human lung kruppel-like factor.. Genomics 60: 78 — 86.  PubMed DOI:10.1006/geno.1999.5888
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Conkright M.D., Wani M.A., Lingrel J.B. (2001). Lung Krueppel-like factor contains an autoinhibitory domain that regulates its transcriptional activation by binding WWP1, an E3 ubiquitin ligase.. J. Biol. Chem. 276: 29299 — 29306.  PubMed DOI:10.1074/jbc.M103670200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6347 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9Y5W3 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]