PGR

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PGR
Protein PGR PDB 1a28.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PGR, NR3C3, PR, progesterone receptor
Зовнішні ІД OMIM: 607311 MGI: 97567 HomoloGene: 713 GeneCards: PGR
Реагує на сполуку
dydrogesterone, Levonorgestrel, Медроксипрогестерон, norethindrone, Прогестерон, promegestone, tanaproget, mifepristone, ulipristal acetate, asoprisnil[1]
Шаблон експресії
PBB GE PGR 208305 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000926
NM_001202474
NM_001271161
NM_001271162
NM_008829
RefSeq (білок)
NP_000917
NP_001189403
NP_001258090
NP_001258091
NP_032855
Локус (UCSC) Хр. 11: 101.03 – 101.13 Mb Хр. 9: 8.9 – 8.97 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PGR (англ. Progesterone receptor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 933 амінокислот, а молекулярна маса — 98 981[5].

Послідовність амінокислот
1020304050
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSA
IPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSS
SSPPEKDSGLLDSVLDTLLAPSGPGQSQPSPPACEVTSSWCLFGPELPED
PPAAPATQRVLSPLMSRSGCKVGDSSGTAAAHKVLPRGLSPARQLLLPAS
ESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGKPRALGGAAAG
GGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTV
MDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASS
TPVAVGDFPDCAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARS
PRSYLVAGANPAAFPDFPLGPPPPLPPRATPSRPGEAAVTAAPASASVSS
ASSSGSTLECILYKAEGAPPQQGPFAPPPCKAPGASGCLLPRDGLPSTSA
SAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPPYLNYLRPDSE
ASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHN
YLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRA
LDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIY
AGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITL
IQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLT
MWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIR
ELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRA
LSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ліпідами, іонами металів, іоном цинку, ДНК, стероїдами. Локалізований у цитоплазмі, ядрі, мембрані, мітохондрії, зовнішній мембрані мітохондрій.

Література[ред. | ред. код]

  • Knotts T.A., Orkiszewski R.S., Cook R.G., Edwards D.P., Weigel N.L. (2001). Identification of a phosphorylation site in the hinge region of the human progesterone receptor and additional amino-terminal phosphorylation sites.. J. Biol. Chem. 276: 8475 — 8483.  PubMed DOI:10.1074/jbc.M009805200
  • McDonnell D.P., Shahbaz M.M., Vegeto E., Goldman M.E. (1994). The human progesterone receptor A-form functions as a transcriptional modulator of mineralocorticoid receptor transcriptional activity.. J. Steroid Biochem. Mol. Biol. 48: 425 — 432.  PubMed DOI:10.1016/0960-0760(94)90190-2
  • Wen D.X., Xu Y.F., Mais D.E., Goldman M.E., McDonnell D.P. (1994). The A and B isoforms of the human progesterone receptor operate through distinct signaling pathways within target cells.. Mol. Cell. Biol. 14: 8356 — 8364.  PubMed DOI:10.1128/MCB.14.12.8356
  • Zhang Y., Beck C.A., Poletti A., Edwards D.P., Weigel N.L. (1995). Identification of a group of Ser-Pro motif hormone-inducible phosphorylation sites in the human progesterone receptor.. Mol. Endocrinol. 9: 1029 — 1040.  PubMed DOI:10.1210/mend.9.8.7476977
  • Beck C.A., Zhang Y., Altmann M., Weigel N.L., Edwards D.P. (1996). Stoichiometry and site-specific phosphorylation of human progesterone receptor in native target cells and in the baculovirus expression system.. J. Biol. Chem. 271: 19546 — 19555.  PubMed DOI:10.1074/jbc.271.32.19546
  • Giangrande P.H., Pollio G., McDonnell D.P. (1997). Mapping and characterization of the functional domains responsible for the differential activity of the A and B isoforms of the human progesterone receptor.. J. Biol. Chem. 272: 32889 — 32900.  PubMed DOI:10.1074/jbc.272.52.32889

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]