CEBPD

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CEBPD
Ідентифікатори
Символи CEBPD, C/EBP-delta, CELF, CRP3, NF-IL6-beta, CCAAT/enhancer binding protein delta, CCAAT enhancer binding protein delta
Зовнішні ІД OMIM: 116898 MGI: 103573 HomoloGene: 3808 GeneCards: CEBPD
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005195
NM_007679
RefSeq (білок)
NP_005186
NP_031705
Локус (UCSC) Хр. 8: 47.74 – 47.74 Mb Хр. 16: 15.89 – 15.89 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CEBPD (англ. CCAAT/enhancer binding protein delta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 269 амінокислот, а молекулярна маса — 28 467[4].

Послідовність амінокислот
1020304050
MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAP
AMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLEL
LPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLA
AAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPEYRQRRER
NNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQF
FKQLPSPPFLPAAGTADCR

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Kinoshita S., Akira S., Kishimoto T. (1992). A member of the C/EBP family, NF-IL6 beta, forms a heterodimer and transcriptionally synergizes with NF-IL6.. Proc. Natl. Acad. Sci. U.S.A. 89: 1473 — 1476.  PubMed DOI:10.1073/pnas.89.4.1473
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Wang J.-M., Ko C.-Y., Chen L.-C., Wang W.-L., Chang W.-C. (2006). Functional role of NF-IL6beta and its sumoylation and acetylation modifications in promoter activation of cyclooxygenase 2 gene.. Nucleic Acids Res. 34: 217 — 231.  PubMed DOI:10.1093/nar/gkj422

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1835 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P49716 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]