TAF7

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TAF7
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TAF7, TAF2F, TAFII55, TATA-box binding protein associated factor 7
Зовнішні ІД OMIM: 600573 MGI: 1346348 HomoloGene: 133942 GeneCards: TAF7
Шаблон експресії
PBB GE TAF7 201023 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005642
NM_175770
RefSeq (білок)
NP_005633
NP_786964
Локус (UCSC) Хр. 5: 141.26 – 141.32 Mb Хр. 18: 37.64 – 37.64 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF7 (англ. TATA-box binding protein associated factor 7) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 349 амінокислот, а молекулярна маса — 40 259[4].

Послідовність амінокислот
1020304050
MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPD
GRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVD
GDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRK
TAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDIS
SPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTE
EDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAK
RQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, поліморфізм. Локалізований у ядрі.

Література[ред. | ред. код]

  • Chiang C.-M., Roeder R.G. (1995). Cloning of an intrinsic human TFIID subunit that interacts with multiple transcriptional activators.. Science 267: 531 — 536.  PubMed DOI:10.1126/science.7824954
  • Zhou T., Chiang C.-M. (2001). The intronless and TATA-less human TAFII55 gene contains a functional initiator and a downstream promoter element.. J. Biol. Chem. 276: 25503 — 25511.  PubMed DOI:10.1074/jbc.M102875200
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Wu S.Y., Thomas M.C., Hou S.Y., Likhite V., Chiang C.M. (1999). Isolation of mouse TFIID and functional characterization of TBP and TFIID in mediating estrogen receptor and chromatin transcription.. J. Biol. Chem. 274: 23480 — 23490.  PubMed DOI:10.1074/jbc.274.33.23480
  • Couture J.-F., Collazo E., Hauk G., Trievel R.C. (2006). Structural basis for the methylation site specificity of SET7/9.. Nat. Struct. Mol. Biol. 13: 140 — 146.  PubMed DOI:10.1038/nsmb1045
  • Kloet S.L., Whiting J.L., Gafken P., Ranish J., Wang E.H. (2012). Phosphorylation-dependent regulation of cyclin D1 and cyclin A gene transcription by TFIID subunits TAF1 and TAF7.. Mol. Cell. Biol. 32: 3358 — 3369.  PubMed DOI:10.1128/MCB.00416-12

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11541 (англ.). Процитовано 5 вересня 2017. 
  4. UniProt, Q15545 (англ.). Процитовано 5 вересня 2017. 

Див. також[ред. | ред. код]