E2F1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
E2F1
Protein E2F1 PDB 2aze.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи E2F1, E2F-1, RBAP1, RBBP3, RBP3, E2F transcription factor 1
Зовнішні ІД OMIM: 189971 MGI: 101941 HomoloGene: 3828 GeneCards: E2F1
Шаблон експресії
PBB GE E2F1 204947 at fs.png

PBB GE E2F1 2028 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005225
NM_007891
NM_001291105
RefSeq (білок)
NP_005216
NP_001278034
NP_031917
Локус (UCSC) Хр. 20: 33.68 – 33.69 Mb Хр. 2: 154.56 – 154.57 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

E2F1 (англ. E2F transcription factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 437 амінокислот, а молекулярна маса — 46 920[4].

Послідовність амінокислот
1020304050
MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTG
PAAPAAGPCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQY
LAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGV
VDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVG
GRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQD
LRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE
ETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSL
LSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFI
SLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, транскрипція, регуляція транскрипції, клітинний цикл, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Neuman E., Sellers W.R.S., McNeil J.A., Lawrence J.B., Kaelin W.G. Jr. (1996). Structure and partial genomic sequence of the human E2F1 gene.. Gene 173: 163 — 169.  PubMed DOI:10.1016/0378-1119(96)00184-9
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Johnson D.G., Ohtani K., Nevins J.R. (1994). Autoregulatory control of E2F1 expression in response to positive and negative regulators of cell cycle progression.. Genes Dev. 8: 1514 — 1525.  PubMed DOI:10.1101/gad.8.13.1514
  • Helin K., Harlow E., Fattaey A. (1993). Inhibition of E2F-1 transactivation by direct binding of the retinoblastoma protein.. Mol. Cell. Biol. 13: 6501 — 6508.  PubMed DOI:10.1128/MCB.13.10.6501
  • Dynlacht B.D., Flores O., Lees J.A., Harlow E. (1994). Differential regulation of E2F transactivation by cyclin/cdk2 complexes.. Genes Dev. 8: 1772 — 1786.  PubMed DOI:10.1101/gad.8.15.1772
  • Xu M., Sheppard K.-A., Peng C.-Y., Yee A.S., Piwnica-Worms H. (1994). Cyclin A/CDK2 binds directly to E2F-1 and inhibits the DNA-binding activity of E2F-1/DP-1 by phosphorylation.. Mol. Cell. Biol. 14: 8420 — 8431.  PubMed DOI:10.1128/MCB.14.12.8420

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3113 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q01094 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]