ZNF146

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF146
Ідентифікатори
Символи ZNF146, OZF, zinc finger protein 146
Зовнішні ІД OMIM: 601505 HomoloGene: 117615 GeneCards: ZNF146
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001099638
NM_001099639
NM_007145
XM_006220772
XM_006247118
RefSeq (білок)
NP_001093108
NP_001093109
NP_009076
XP_006223243
XP_017443037
Локус (UCSC) Хр. 19: 36.21 – 36.24 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF146 (англ. Zinc finger protein 146) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 292 амінокислот, а молекулярна маса — 33 308[4].

Послідовність амінокислот
1020304050
MSHLSQQRIYSGENPFACKVCGKVFSHKSNLTEHEHFHTREKPFECNECG
KAFSQKQYVIKHQNTHTGEKLFECNECGKSFSQKENLLTHQKIHTGEKPF
ECKDCGKAFIQKSNLIRHQRTHTGEKPFVCKECGKTFSGKSNLTEHEKIH
IGEKPFKCSECGTAFGQKKYLIKHQNIHTGEKPYECNECGKAFSQRTSLI
VHVRIHSGDKPYECNVCGKAFSQSSSLTVHVRSHTGEKPYGCNECGKAFS
QFSTLALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKIHTH

Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ferbus D., Bovin C., Validire P., Goubin G. (2003). The zinc finger protein OZF (ZNF146) is overexpressed in colorectal cancer.. J. Pathol. 200: 177 — 182.  PubMed DOI:10.1002/path.1337
  • Antoine K., Ferbus D., Kolahgar G., Prosperi M.-T., Goubin G. (2005). Zinc finger protein overexpressed in colon carcinoma interacts with the telomeric protein hRap1.. J. Cell. Biochem. 95: 763 — 768.  PubMed DOI:10.1002/jcb.20487
  • Antoine K., Prosperi M.-T., Ferbus D., Boule C., Goubin G. (2005). A Kruppel zinc finger of ZNF 146 interacts with the SUMO-1 conjugating enzyme UBC9 and is sumoylated in vivo.. Mol. Cell. Biochem. 271: 215 — 223.  PubMed DOI:10.1007/s11010-005-6417-2
  • Pibouin L., Villaudy J., Prosperi M.-T., Goubin G. (2001). Genomic organization and promoter identification of ZNF146, a gene encoding a protein consisting solely of zinc finger domains.. Cytogenet. Cell Genet. 92: 80 — 84.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:12931 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q15072 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]