NFE2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NFE2
Protein NFE2 PDB 1LVX.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NFE2, NF-E2, p45, nuclear factor, erythroid 2
Зовнішні ІД OMIM: 601490 MGI: 97308 HomoloGene: 4491 GeneCards: NFE2
Шаблон експресії
PBB GE NFE2 209930 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001136023
NM_001261461
NM_006163
RefSeq (білок)
NP_001129495
NP_001248390
NP_006154
Локус (UCSC) Хр. 12: 54.29 – 54.3 Mb Хр. 15: 103.25 – 103.26 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NFE2 (англ. Nuclear factor, erythroid 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 373 амінокислот, а молекулярна маса — 41 473[4].

Послідовність амінокислот
1020304050
MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEP
QAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYG
NMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPESDSGLSL
NYSDAESLELEGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLPAAE
TPLALEPSSGPVRAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDF
NELLARYPLTESQLALVRDIRRRGKNKVAAQNCRKRKLETIVQLERELER
LTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSPEEY
ALQQAADGTIFLVPRGTKMEATD

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Chan J.Y., Han X.L., Kan Y.W. (1993). Isolation of cDNA encoding the human NF-E2 protein.. Proc. Natl. Acad. Sci. U.S.A. 90: 11366 — 11370.  PubMed DOI:10.1073/pnas.90.23.11366
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hung H.-L., Kim A.Y., Hong W., Rakowski C., Blobel G.A. (2001). Stimulation of NF-E2 DNA binding by CREB-binding protein (CBP)-mediated acetylation.. J. Biol. Chem. 276: 10715 — 10721.  PubMed DOI:10.1074/jbc.M007846200
  • Lee T.-L., Shyu Y.-C., Hsu T.-Y., Shen C.-K.J. (2008). Itch regulates p45/NF-E2 in vivo by Lys63-linked ubiquitination.. Biochem. Biophys. Res. Commun. 375: 326 — 330.  PubMed DOI:10.1016/j.bbrc.2008.07.164

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7780 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q16621 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]