HSF4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HSF4
Ідентифікатори
Символи HSF4, CTM, CTRCT5, heat shock transcription factor 4
Зовнішні ІД OMIM: 602438 MGI: 1347058 HomoloGene: 100128 GeneCards: HSF4
Пов'язані генетичні захворювання
cataract 5 multiple types[1]
Шаблон експресії
PBB GE HSF4 210977 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001538
NM_001040667
NM_001374674
NM_001374675
NM_001256042
NM_001256044
NM_011939
RefSeq (білок)
NP_001035757
NP_001529
NP_001361603
NP_001361604
NP_001242971
NP_001242973
NP_036069
Локус (UCSC) Хр. 16: 67.16 – 67.17 Mb Хр. 8: 105.27 – 105.28 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HSF4 (англ. Heat shock transcription factor 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 492 амінокислот, а молекулярна маса — 53 011[5].

Послідовність амінокислот
1020304050
MQEAPAALPTEPGPSPVPAFLGKLWALVGDPGTDHLIRWSPSGTSFLVSD
QSRFAKEVLPQYFKHSNMASFVRQLNMYGFRKVVSIEQGGLLRPERDHVE
FQHPSFVRGREQLLERVRRKVPALRGDDGRWRPEDLGRLLGEVQALRGVQ
ESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGP
SNAGGKRKLSLMLDEGSSCPTPAKFNTCPLPGALLQDPYFIQSPLPETNL
GLSPHRARGPIISDIPEDSPSPEGTRLSPSSDGRREKGLALLKEEPASPG
GDGEAGLALAPNECDFCVTAPPPLPVAVVQAILEGKGSFSPEGPRNAQQP
EPGDPREIPDRGPLGLESGDRSPESLLPPMLLQPPQESVEPAGPLDVLGP
SLQGREWTLMDLDMELSLMQPLVPERGEPELAVKGLNSPSPGKDPTLGAP
LLLDVQAALGGPALGLPGALTIYSTPESRTASYLGPEASPSP

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як відповідь на стрес, транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Hu Y., Mivechi N.F. (2006). Association and regulation of heat shock transcription factor 4b with both extracellular signal-regulated kinase mitogen-activated protein kinase and dual-specificity tyrosine phosphatase DUSP26.. Mol. Cell. Biol. 26: 3282 — 3294.  PubMed DOI:10.1128/MCB.26.8.3282-3294.2006

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]