HOXB7

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HOXB7
Protein HOXB7 PDB 1ahd.png
Ідентифікатори
Символи HOXB7, HHO.C1, HOX2, HOX2C, Hox-2.3, homeobox B7
Зовнішні ІД OMIM: 142962 MGI: 96188 HomoloGene: 55828 GeneCards: HOXB7
Шаблон експресії
PBB GE HOXB7 204779 s at fs.png

PBB GE HOXB8 204778 x at fs.png

PBB GE HOXB7 216973 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004502
NM_010460
RefSeq (білок)
NP_004493
NP_034590
Локус (UCSC) Хр. 17: 48.61 – 48.63 Mb Хр. 11: 96.29 – 96.29 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HOXB7 (англ. Homeobox B7) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 217 амінокислот, а молекулярна маса — 24 015[4].

Послідовність амінокислот
1020304050
MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGAS
FAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVC
PGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTL
ELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAG
PGTTGQDRAEAEEEEEE

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Baier L.J., Hannibal M.C., Hanley E.W., Nabel G.J. (1991). Lymphoid expression and TATAA binding of a human protein containing an Antennapedia homeodomain.. Blood 78: 1047 — 1055.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5118 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P09629 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]