MEF2A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MEF2A
Protein MEF2A PDB 1c7u.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MEF2A, ADCAD1, RSRFC4, RSRFC9, mef2, myocyte enhancer factor 2A
Зовнішні ІД OMIM: 600660 MGI: 99532 HomoloGene: 4080 GeneCards: MEF2A
Шаблон експресії
PBB GE MEF2A 208328 s at fs.png

PBB GE MEF2A 212535 at fs.png

PBB GE MEF2A 214684 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 15: 99.57 – 99.72 Mb Хр. 7: 67.23 – 67.37 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MEF2A (англ. Myocyte enhancer factor 2A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 507 амінокислот, а молекулярна маса — 54 811[4].

Послідовність амінокислот
1020304050
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNS
SNKLFQYASTDMDKVLLKYTEYNEPHESRTNSDIVEALNKKEHRGCDSPD
PDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNFSMSVTVPVTS
PNALSYTNPGSSLVSPSLAASSTLTDSSMLSPPQTTLHRNVSPGAPQRPP
STGNAGGMLSTTDLTVPNGAGSSPVGNGFVNSRASPNLIGATGANSLGKV
MPTKSPPPPGGGNLGMNSRKPDLRVVIPPSSKGMMPPLSEEEELELNTQR
ISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSAL
QGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNI
SIKSEPISPPRDRMTPSGFQQQQQQQQQQQPPPPPQPQPQPPQPQPRQEM
GRSPVDSLSSSSSSYDGSDREDPRGDFHSPIVLGRPPNTEDRESPSVKRM
RMDAWVT

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, транскрипція, регуляція транскрипції, диференціація клітин, нейрогенез, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Pollock R., Treisman R. (1991). Human SRF-related proteins: DNA-binding properties and potential regulatory targets.. Genes Dev. 5: 2327 — 2341.  PubMed DOI:10.1101/gad.5.12a.2327
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Yang C.-C., Ornatsky O.I., McDermott J.C., Cruz T.F., Prody C.A. (1998). Interaction of myocyte enhancer factor 2 (MEF2) with a mitogen-activated protein kinase, ERK5/BMK1.. Nucleic Acids Res. 26: 4771 — 4777.  PubMed DOI:10.1093/nar/26.20.4771
  • Yang S.-H., Galanis A., Sharrocks A.D. (1999). Targeting of p38 mitogen-activated protein kinases to MEF2 transcription factors.. Mol. Cell. Biol. 19: 4028 — 4038.  PubMed DOI:10.1128/MCB.19.6.4028
  • Knight J.B., Eyster C.A., Griesel B.A., Olson A.L. (2003). Regulation of the human GLUT4 gene promoter: interaction between a transcriptional activator and myocyte enhancer factor 2A.. Proc. Natl. Acad. Sci. U.S.A. 100: 14725 — 14730.  PubMed DOI:10.1073/pnas.2432756100
  • Zhu B., Ramachandran B., Gulick T. (2005). Alternative pre-mRNA splicing governs expression of a conserved acidic transactivation domain in myocyte enhancer factor 2 factors of striated muscle and brain.. J. Biol. Chem. 280: 28749 — 28760.  PubMed DOI:10.1074/jbc.M502491200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6993 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q02078 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]