MYC

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYC
Ідентифікатори
Символи myc proto-oncogene proteinMYCavian myelocytomatosis viral oncogene homologv-myc avian myelocytomatosis viral oncogene homologmyc-related translation/localization regulatory factorproto-oncogene c-Mycclass E basic helix-loop-helix protein 39transcription factor p64bHLHe39v-myc myelocytomatosis viral oncogene homolog
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

MYC (англ. MYC proto-oncogene, bHLH transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 439 амінокислот, а молекулярна маса — 48 804[2].

Послідовність амінокислот
1020304050
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIW
KKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLE
MVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLA
SYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLN
DSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSS
DSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDT
EENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKAT
AYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Colby W.W., Chen E.Y., Smith D.H., Levinson A.D. (1983). Identification and nucleotide sequence of a human locus homologous to the v-myc oncogene of avian myelocytomatosis virus MC29.. Nature 301: 722 — 725.  PubMed DOI:10.1038/301722a0
  • Rabbitts T.H., Hamlyn P.H., Baer R. (1983). Altered nucleotide sequences of a translocated c-myc gene in Burkitt lymphoma.. Nature 306: 760 — 765.  PubMed DOI:10.1038/306760a0
  • Watson D.K., Psallidopoulos M.C., Samuel K.P., Dalla-Favera R., Papas T.S. (1983). Nucleotide sequence analysis of human c-myc locus, chicken homologue, and myelocytomatosis virus MC29 transforming gene reveals a highly conserved gene product.. Proc. Natl. Acad. Sci. U.S.A. 80: 3642 — 3645.  PubMed DOI:10.1073/pnas.80.12.3642
  • Rabbitts T.H., Forster A., Hamlyn P., Baer R. (1984). Effect of somatic mutation within translocated c-myc genes in Burkitt's lymphoma.. Nature 309: 592 — 597.  PubMed DOI:10.1038/309592a0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bentley D.L., Groudine M. (1986). Novel promoter upstream of the human c-myc gene and regulation of c-myc expression in B-cell lymphomas.. Mol. Cell. Biol. 6: 3481 — 3489.  PubMed DOI:10.1128/MCB.6.10.3481

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:7553 (англ.). Процитовано 7 вересня 2017. 
  2. UniProt, P01106 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]