FOXO1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOXO1
Protein FOXO1 PDB 3CO6.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FOXO1, FKH1, FKHR, FOXO1A, forkhead box O1
Зовнішні ІД OMIM: 136533 MGI: 1890077 HomoloGene: 1527 GeneCards: FOXO1
Пов'язані генетичні захворювання
alveolar rhabdomyosarcoma[1]
Шаблон експресії
PBB GE FOXO1A 202723 s at fs.png

PBB GE FOXO1A 202724 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002015
NM_019739
RefSeq (білок)
NP_002006
NP_062713
Локус (UCSC) Хр. 13: 40.47 – 40.67 Mb Хр. 3: 52.27 – 52.35 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FOXO1 (англ. Forkhead box O1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 13-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 655 амінокислот, а молекулярна маса — 69 662[5].

Послідовність амінокислот
1020304050
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAA
NPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAA
AATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPR
KSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDK
GDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSP
RRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPG
SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPP
SAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQ
QTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYG
GMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGP
NSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTS
GMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPS
DLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTH
SWVSG

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, транскрипція, регуляція транскрипції, автофагія, диференціація клітин, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Anderson M.J., Viars C.S., Czekay S., Cavenee W.K., Arden K.C. (1998). Cloning and characterization of three human forkhead genes that comprise an FKHR-like gene subfamily.. Genomics 47: 187 — 199.  PubMed DOI:10.1006/geno.1997.5122
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Rena G., Guo S., Cichy S.C., Unterman T.G., Cohen P. (1999). Phosphorylation of the transcription factor forkhead family member FKHR by protein kinase B.. J. Biol. Chem. 274: 17179 — 17183.  PubMed DOI:10.1074/jbc.274.24.17179
  • Rena G., Prescott A.R., Guo S., Cohen P., Unterman T.G. (2001). Roles of the forkhead in rhabdomyosarcoma (FKHR) phosphorylation sites in regulating 14-3-3 binding, transactivation and nuclear targetting.. Biochem. J. 354: 605 — 612.  PubMed DOI:10.1042/0264-6021:3540605
  • Perrot V., Rechler M.M. (2005). The coactivator p300 directly acetylates the forkhead transcription factor Foxo1 and stimulates Foxo1-induced transcription.. Mol. Endocrinol. 19: 2283 — 2298.  PubMed DOI:10.1210/me.2004-0292
  • Brent M.M., Anand R., Marmorstein R. (2008). Structural basis for DNA recognition by FoxO1 and its regulation by posttranslational modification.. Structure 16: 1407 — 1416.  PubMed DOI:10.1016/j.str.2008.06.013

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]