ZNF350

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF350
Ідентифікатори
Символи ZNF350, ZBRK1, ZFQR, zinc finger protein 350
Зовнішні ІД OMIM: 605422 HomoloGene: 130723 GeneCards: ZNF350
Шаблон експресії
PBB GE ZNF350 219266 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_021632
н/д
RefSeq (білок)
NP_067645
н/д
Локус (UCSC) Хр. 19: 51.96 – 51.99 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

ZNF350 (англ. Zinc finger protein 350) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 532 амінокислот, а молекулярна маса — 60 011[3].

Послідовність амінокислот
1020304050
MIQAQESITLEDVAVDFTWEEWQLLGAAQKDLYRDVMLENYSNLVAVGYQ
ASKPDALFKLEQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRR
KPCHEHDAFENIVHCSKSQFLLGQNHDIFDLRGKSLKSNLTLVNQSKGYE
IKNSVEFTGNGDSFLHANHERLHTAIKFPASQKLISTKSQFISPKHQKTR
KLEKHHVCSECGKAFIKKSWLTDHQVMHTGEKPHRCSLCEKAFSRKFMLT
EHQRTHTGEKPYECPECGKAFLKKSRLNIHQKTHTGEKPYICSECGKGFI
QKGNLIVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSE
CGKSCSQKSGLIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGER
PYGCNECGKAFAYMSCLVKHKRIHTREKQEAAKVENPPAERHSSLHTSDV
MQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVGQPVVRCAASGDN
RGFAQDRNLVNAVNVVVPSVINYVLFYVTENP

Кодований геном білок за функцією належить до репресорів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Li H., Seth A.K. (2004). An RNF11: Smurf2 complex mediates ubiquitination of the AMSH protein.. Oncogene 23: 1801 — 1808.  PubMed DOI:10.1038/sj.onc.1207319

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:16656 (англ.). Процитовано 12 вересня 2017. 
  3. UniProt, Q9GZX5 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]