CEBPA

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CEBPA
1nwq.png
Ідентифікатори
Символи CEBPA, C/EBP-alpha, CEBP, CCAAT/enhancer binding protein alpha, CCAAT enhancer binding protein alpha
Зовнішні ІД OMIM: 116897 MGI: 99480 HomoloGene: 3211 GeneCards: CEBPA
Пов'язані генетичні захворювання
Гострий мієлоїдний лейкоз[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004364
NM_001285829
NM_001287424
NM_001287435
NM_001287514
NM_001287515
NM_001287521
NM_001287523
NM_007678
RefSeq (білок)
NP_001272758
NP_001274353
NP_001274364
NP_004355
NP_001274443
NP_001274444
NP_001274450
NP_001274452
NP_031704
Локус (UCSC) Хр. 19: 33.3 – 33.3 Mb Хр. 7: 35.12 – 35.12 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CEBPA (англ. CCAAT/enhancer binding protein alpha) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 358 амінокислот, а молекулярна маса — 37 561[5].

Послідовність амінокислот
1020304050
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPE
PLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGG
GGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERV
GAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAH
LAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPG
SALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR
DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSL
VKAMGNCA

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Antonson P., Xanthopoulos K.G. (1995). Molecular cloning, sequence, and expression patterns of the human gene encoding CCAAT/enhancer binding protein alpha (C/EBP alpha).. Biochem. Biophys. Res. Commun. 215: 106 — 113.  PubMed DOI:10.1006/bbrc.1995.2439
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Choi B.H., Park G.T., Rho H.M. (1999). Interaction of hepatitis B viral X protein and CCAAT/enhancer-binding protein alpha synergistically activates the hepatitis B viral enhancer II/pregenomic promoter.. J. Biol. Chem. 274: 2858 — 2865.  PubMed DOI:10.1074/jbc.274.5.2858
  • Wang G.L., Iakova P., Wilde M., Awad S., Timchenko N.A. (2004). Liver tumors escape negative control of proliferation via PI3K/Akt-mediated block of C/EBP alpha growth inhibitory activity.. Genes Dev. 18: 912 — 925.  PubMed DOI:10.1101/gad.1183304
  • Muller C., Calkhoven C.F., Sha X., Leutz A. (2004). The CCAAT enhancer-binding protein alpha (C/EBPalpha) requires a SWI/SNF complex for proliferation arrest.. J. Biol. Chem. 279: 7353 — 7358.  PubMed DOI:10.1074/jbc.M312709200
  • Smith M.L., Cavenagh J.D., Lister T.A., Fitzgibbon J. (2004). Mutation of CEBPA in familial acute myeloid leukemia.. N. Engl. J. Med. 351: 2403 — 2407.  PubMed DOI:10.1056/NEJMoa041331

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]