MSX1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MSX1
Protein MSX1 PDB 1ig7.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MSX1, ECTD3, HOX7, HYD1, STHAG1, msh homeobox 1
Зовнішні ІД OMIM: 142983 MGI: 97168 HomoloGene: 1836 GeneCards: MSX1
Пов'язані генетичні захворювання
tooth and nail syndrome[1]
Шаблон експресії
PBB GE MSX1 205932 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002448
NM_010835
RefSeq (білок)
NP_002439
NP_034965
Локус (UCSC) Хр. 4: 4.86 – 4.86 Mb Хр. 5: 37.82 – 37.82 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MSX1 (англ. Msh homeobox 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 303 амінокислот, а молекулярна маса — 31 496[5].

Послідовність амінокислот
1020304050
MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGA
KPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPP
GSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPR
FSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIA
ERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAA
FGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMY
HLT

Кодований геном білок за функціями належить до репресорів, білків розвитку. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Hewitt J.E., Clarke L.E., Iven A., Williamson R. (1991). Structure and sequence of the human homeobox gene HOX7.. Genomics 11: 670 — 678.  PubMed DOI:10.1016/0888-7543(91)90074-O
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Vastardis H., Karimbux N., Guthua S.W., Seidman J.G., Seidman C.E. (1996). A human MSX1 homeodomain missense mutation causes selective tooth agenesis.. Nat. Genet. 13: 417 — 421.  PubMed DOI:10.1038/ng0896-417
  • Lidral A.C., Reising B.C. (2002). The role of MSX1 in human tooth agenesis.. J. Dent. Res. 81: 274 — 278.  PubMed DOI:10.1177/154405910208100410

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]