ATF5

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ATF5
Ідентифікатори
Символи ATF5, ATFX, HMFN0395, activating transcription factor 5
Зовнішні ІД OMIM: 606398 MGI: 2141857 HomoloGene: 32142 GeneCards: ATF5
Шаблон експресії
PBB GE ATF5 204998 s at fs.png

PBB GE ATF5 204999 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001193646
NM_001290746
NM_012068
NM_030693
RefSeq (білок)
NP_001180575
NP_001277675
NP_036200
NP_109618
Локус (UCSC) Хр. 19: 49.93 – 49.93 Mb Хр. 7: 44.81 – 44.82 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ATF5 (англ. Activating transcription factor 5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 282 амінокислот, а молекулярна маса — 30 674[4].

Послідовність амінокислот
1020304050
MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGG
LPVGGEPLAGDGFSDWMTERVDFTALLPLEPPLPPGTLPQPSPTPPDLEA
MASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDL
PQPPVLDTLDLLAIYCRNEAGQEEVGMPPLPPPQQPPPPSPPQPSRLAPY
PHPATTRGDRKQKKRDQNKSAALRYRQRKRAEGEALEGECQGLEARNREL
KERAESVEREIQYVKDLLIEVYKARSQRTRSC

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, цитоскелеті, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Pati D., Meistrich M.L., Plon S.E. (1999). Human Cdc34 and Rad6B ubiquitin-conjugating enzymes target repressors of cyclic AMP-induced transcription for proteolysis.. Mol. Cell. Biol. 19: 5001 — 5013.  PubMed DOI:10.1128/MCB.19.7.5001
  • Pascual M., Gomez-Lechon M.J., Castell J.V., Jover R. (2008). ATF5 is a highly abundant liver-enriched transcription factor that cooperates with constitutive androstane receptor in the transactivation of CYP2B6: implications in hepatic stress responses.. Drug Metab. Dispos. 36: 1063 — 1072.  PubMed DOI:10.1124/dmd.107.019380
  • Dluzen D., Li G., Tacelosky D., Moreau M., Liu D.X. (2011). BCL-2 is a downstream target of ATF5 that mediates the prosurvival function of ATF5 in a cell type-dependent manner.. J. Biol. Chem. 286: 7705 — 7713.  PubMed DOI:10.1074/jbc.M110.207639
  • Liu D.X., Qian D., Wang B., Yang J.M., Lu Z. (2011). p300-Dependent ATF5 acetylation is essential for Egr-1 gene activation and cell proliferation and survival.. Mol. Cell. Biol. 31: 3906 — 3916.  PubMed DOI:10.1128/MCB.05887-11

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:790 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9Y2D1 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]