HNF4A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HNF4A
Protein HNF4A PDB 1m7w.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HNF4A, HNF4, HNF4a7, HNF4a8, HNF4a9, HNF4alpha, MODY, MODY1, NR2A1, NR2A21, TCF, TCF14, FRTS4, Hepatocyte nuclear factor 4 alpha
Зовнішні ІД OMIM: 600281 MGI: 109128 HomoloGene: 395 GeneCards: HNF4A
Пов'язані генетичні захворювання
Цукровий діабет 2-го типу, Fanconi renotubular syndrome 4 with Maturity-onset diabetes of the young, rare genetic diabetes mellitus[1]
Реагує на сполуку
Лінолева кислота[2]
Шаблон експресії
PBB GE HNF4A 208429 x at fs.png

PBB GE HNF4A 216889 s at fs.png

PBB GE HNF4A 214832 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_008261
NM_001312906
NM_001312907
RefSeq (білок)
NP_001299835
NP_001299836
NP_032287
Локус (UCSC) Хр. 20: 44.36 – 44.43 Mb Хр. 2: 163.51 – 163.57 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HNF4A (англ. Hepatocyte nuclear factor 4 alpha) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 474 амінокислот, а молекулярна маса — 52 785[6].

Послідовність амінокислот
1020304050
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNA
PNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSR
QCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLP
SINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVE
WAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYI
VPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK
GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQ
MIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGT
NVIVANTMPTHLSNGQMCEWPRPRGQAATPETPQPSPPGGSGSEPYKLLP
GAVATIVKPLSAIPQPTITKQEVI

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Drewes T., Senkel S., Holewa B., Ryffel G.U. (1996). Human hepatocyte nuclear factor 4 isoforms are encoded by distinct and differentially expressed genes.. Mol. Cell. Biol. 16: 925 — 931.  PubMed DOI:10.1128/MCB.16.3.925
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Chartier F.L., Bossu J.-P., Laudet V., Fruchart J.-C., Laine B. (1994). Cloning and sequencing of cDNAs encoding the human hepatocyte nuclear factor 4 indicate the presence of two isoforms in human liver.. Gene 147: 269 — 272.  PubMed DOI:10.1016/0378-1119(94)90079-5
  • Ktistaki E., Ktistakis N.T., Papadogeorgaki E., Talianidis I. (1995). Recruitment of hepatocyte nuclear factor 4 into specific intranuclear compartments depends on tyrosine phosphorylation that affects its DNA-binding and transactivation potential.. Proc. Natl. Acad. Sci. U.S.A. 92: 9876 — 9880.  PubMed DOI:10.1073/pnas.92.21.9876
  • Hong Y.H., Varanasi U.S., Yang W., Leff T. (2003). AMP-activated protein kinase regulates HNF4alpha transcriptional activity by inhibiting dimer formation and decreasing protein stability.. J. Biol. Chem. 278: 27495 — 27501.  PubMed DOI:10.1074/jbc.M304112200
  • Duda K., Chi Y.-I., Shoelson S.E. (2004). Structural basis for HNF-4alpha activation by ligand and coactivator binding.. J. Biol. Chem. 279: 23311 — 23316.  PubMed DOI:10.1074/jbc.M400864200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]