ARID4A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ARID4A
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ARID4A, RBBP-1, RBBP1, RBP-1, RBP1, AT-rich interaction domain 4A
Зовнішні ІД OMIM: 180201 MGI: 2444354 HomoloGene: 11303 GeneCards: ARID4A
Шаблон експресії
PBB GE ARID4A 205062 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002892
NM_023000
NM_023001
NM_001081195
RefSeq (білок)
NP_002883
NP_075376
NP_075377
NP_001074664
Локус (UCSC) Хр. 14: 58.3 – 58.37 Mb Хр. 12: 71.02 – 71.1 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ARID4A (англ. AT-rich interaction domain 4A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 257 амінокислот, а молекулярна маса — 142 752[4].

Послідовність амінокислот
1020304050
MKAADEPAYLTVGTDVSAKYRGAFCEAKIKTVKRLVKVKVLLKQDNTTQL
VQDDQVKGPLRVGAIVETRTSDGSFQEAIISKLTDASWYTVVFDDGDERT
LRRTSLCLKGERHFAESETLDQLPLTNPEHFGTPVIAKKTNRGRRSSLPV
TEDEKEEESSEEEDEDKRRLNDELLGKVVSVVSATERTEWYPALVISPSC
NDDITVKKDQCLVRSFIDSKFYSIARKDIKEVDILNLPESELSTKPGLQK
ASIFLKTRVVPDNWKMDISEILESSSSDDEDGPAEENDEEKEKEAKKTEE
EVPEEELDPEERDNFLQQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLV
YHQGGCDNIDSGAVWKQIYMDLGIPILNSAASYNVKTAYRKYLYGFEEYC
RSANIQFRTVHHHEPKVKEEKKDLEESMEEALKLDQEMPLTEVKSEPEEN
IDSNSESEREEIELKSPRGRRRIARDVNSIKKEIEEEKTEDKLKDNDTEN
KDVDDDYETAEKKENELLLGRKNTPKQKEKKIKKQEDSDKDSDEEEEKSQ
EREETESKCDSEGEEDEEDMEPCLTGTKVKVKYGRGKTQKIYEASIKSTE
IDDGEVLYLVHYYGWNVRYDEWVKADRIIWPLDKGGPKKKQKKKAKNKED
SEKDEKRDEERQKSKRGRPPLKSTLSSNMPYGLSKTANSEGKSDSCSSDS
ETEDALEKNLINEELSLKDELEKNENLNDDKLDEENPKISAHILKENDRT
QMQPLETLKLEVGENEQIVQIFGNKMEKTEEVKKEAEKSPKGKGRRSKTK
DLSLEIIKISSFGQNEAGSEPHIEAHSLELSSLDNKNFSSATEDEIDQCV
KEKKLKRKILGQSSPEKKIRIENGMEMTNTVSQERTSDCIGSEGMKNLNF
EQHFERENEGMPSLIAESNQCIQQLTSERFDSPAEETVNIPLKEDEDAMP
LIGPETLVCHEVDLDDLDEKDKTSIEDVAVESSESNSLVSIPPALPPVVQ
HNFSVASPLTLSQDESRSVKSESDITIEVDSIAEESQEGLCERESANGFE
TNVASGTCSIIVQERESREKGQKRPSDGNSGLMAKKQKRTPKRTSAAAKN
EKNGTGQSSDSEDLPVLDNSSKCTPVKHLNVSKPQKLARSPARISPHIKD
GEKDKHREKHPNSSPRTYKWSFQLNELDNMNSTERISFLQEKLQEIRKYY
MSLKSEVATIDRRRKRLKKKDREVSHAGASMSSASSDTGMSPSSSSPPQN
VLAVECR

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Локалізований у ядрі.

Література[ред. | ред. код]

  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033
  • Otterson G.A., Kratzke R.A., Lin A.Y., Johnston P.G., Kaye F.J. (1993). Alternative splicing of the RBP1 gene clusters in an internal exon that encodes potential phosphorylation sites.. Oncogene 8: 949 — 957.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9885 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P29374 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]