HMGA1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HMGA1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HMGA1, HMG-R, HMGA1A, HMGIY, high mobility group AT-hook 1
Зовнішні ІД OMIM: 600701 MGI: 96160 HomoloGene: 128226 GeneCards: HMGA1
Шаблон експресії
PBB GE HMGA1 210457 x at fs.png

PBB GE HMGA1 206074 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
NP_001159948
NP_001159949
Локус (UCSC) Хр. 6: 34.24 – 34.25 Mb Хр. 17: 27.56 – 27.56 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HMGA1 (англ. High mobility group AT-hook 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 107 амінокислот, а молекулярна маса — 11 676[4].

Послідовність амінокислот
1020304050
MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSE
VPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQ
ESSEEEQ

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, хромосомах.

Література[ред. | ред. код]

  • Eckner R., Birnstiel M.L. (1989). Cloning of cDNAs coding for human HMG I and HMG Y proteins: both are capable of binding to the octamer sequence motif.. Nucleic Acids Res. 17: 5947 — 5959.  PubMed DOI:10.1093/nar/17.15.5947
  • Johnson K.R., Lehn D.A., Reeves R. (1989). Alternative processing of mRNAs encoding mammalian chromosomal high-mobility-group proteins HMG-I and HMG-Y.. Mol. Cell. Biol. 9: 2114 — 2123.  PubMed DOI:10.1128/MCB.9.5.2114
  • Friedmann M., Holth L.T., Zoghbi H.Y., Reeves R. (1993). Organization, inducible-expression and chromosome localization of the human HMG-I(Y) nonhistone protein gene.. Nucleic Acids Res. 21: 4259 — 4267.  PubMed DOI:10.1093/nar/21.18.4259
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lund T., Dahl K.H., Mork E., Holtlund J., Laland S.G. (1987). The human chromosomal protein HMG I contains two identical palindrome amino acid sequences.. Biochem. Biophys. Res. Commun. 146: 725 — 730.  PubMed DOI:10.1016/0006-291X(87)90589-4
  • Karlson J.R., Mork E., Holtlund J., Laland S.G., Lund T. (1989). The amino acid sequence of the chromosomal protein HMG-Y, its relation to HMG-I and possible domains for the preferential binding of the proteins to stretches of A-T base pairs.. Biochem. Biophys. Res. Commun. 158: 646 — 651.  PubMed DOI:10.1016/0006-291X(89)92770-8

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5010 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, P17096 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]