MYCN

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYCN
Ідентифікатори
Символи MYCN, MODED, N-myc, NMYC, ODED, bHLHe37, v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog, MYCN proto-oncogene, bHLH transcription factor
Зовнішні ІД OMIM: 164840 MGI: 97357 HomoloGene: 3922 GeneCards: MYCN
Шаблон експресії
PBB GE MYCN 209756 s at fs.png

PBB GE MYCN 209757 s at fs.png

PBB GE MYCN 211377 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005378
NM_001293228
NM_001293231
NM_001293233
NM_008709
RefSeq (білок)
NP_001280157
NP_001280160
NP_001280162
NP_005369
NP_032735
Локус (UCSC) Хр. 2: 15.94 – 15.95 Mb Хр. 12: 12.94 – 12.94 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYCN (англ. MYCN proto-oncogene, bHLH transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 464 амінокислот, а молекулярна маса — 49 561[4].

Послідовність амінокислот
1020304050
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIW
KKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLG
GLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGPPTAGSTAQSP
GAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKR
EPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHK
ALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTIT
VRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKI
KSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSS
FLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQAR
QQQLLKKIEHARTC

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Stanton L.W., Schwab M., Bishop J.M. (1986). Nucleotide sequence of the human N-myc gene.. Proc. Natl. Acad. Sci. U.S.A. 83: 1772 — 1776.  PubMed DOI:10.1073/pnas.83.6.1772
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Stanton L.W., Bishop J.M. (1987). Alternative processing of RNA transcribed from NMYC.. Mol. Cell. Biol. 7: 4266 — 4272.  PubMed DOI:10.1128/MCB.7.12.4266
  • Michitsch R.W., Melera P.W. (1985). Nucleotide sequence of the 3' exon of the human N-myc gene.. Nucleic Acids Res. 13: 2545 — 2558.  PubMed DOI:10.1093/nar/13.7.2545
  • Secombe J., Li L., Carlos L., Eisenman R.N. (2007). The Trithorax group protein Lid is a trimethyl histone H3K4 demethylase required for dMyc-induced cell growth.. Genes Dev. 21: 537 — 551.  PubMed DOI:10.1101/gad.1523007
  • Ibson J.M., Rabbitts P.H. (1988). Sequence of a germ-line N-myc gene and amplification as a mechanism of activation.. Oncogene 2: 399 — 402.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7559 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, P04198 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]