SMAD3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SMAD3
Protein SMAD3 PDB 1dev.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SMAD3, HSPC193, HsT17436, JV15-2, LDS1C, LDS3, MADH3, SMAD family member 3
Зовнішні ІД OMIM: 603109 MGI: 1201674 HomoloGene: 55937 GeneCards: SMAD3
Пов'язані генетичні захворювання
inflammatory bowel disease, Хвороба Крона, бронхіальна астма, Ішемічна хвороба серця, колоректальний рак, aneurysm-osteoarthritis syndrome[1]
Шаблон експресії
PBB GE SMAD3 205396 at fs.png

PBB GE SMAD3 205398 s at fs.png

PBB GE SMAD3 205397 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001145102
NM_001145103
NM_001145104
NM_005902
NM_016769
RefSeq (білок)
NP_001138574
NP_001138575
NP_001138576
NP_005893
NP_058049
Локус (UCSC) Хр. 15: 67.06 – 67.2 Mb Хр. 9: 63.65 – 63.76 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SMAD3 (англ. SMAD family member 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 15-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 425 амінокислот, а молекулярна маса — 48 081[5].

Послідовність амінокислот
1020304050
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDE
LEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSH
HELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEF
PPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSM
DAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHA
SQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAA
LLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHL
NGPLQWLDKVLTQMGSPSIRCSSVS

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Zhang Y., Feng X.-H., Wu R.-Y., Derynck R. (1996). Receptor-associated Mad homologues synergize as effectors of the TGF-beta response.. Nature 383: 168 — 172.  PubMed DOI:10.1038/383168a0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tsukazaki T., Chiang T.A., Davison A.F., Attisano L., Wrana J.L. (1998). SARA, a FYVE domain protein that recruits Smad2 to the TGFbeta receptor.. Cell 95: 779 — 791.  PubMed DOI:10.1016/S0092-8674(00)81701-8
  • Kawabata M., Inoue H., Hanyu A., Imamura T., Miyazono K. (1998). Smad proteins exist as monomers in vivo and undergo homo- and hetero-oligomerization upon activation by serine/threonine kinase receptors.. EMBO J. 17: 4056 — 4065.  PubMed DOI:10.1093/emboj/17.14.4056
  • Zhang Y., Feng X.H., Derynck R. (1998). Smad3 and Smad4 cooperate with c-Jun/c-Fos to mediate TGF-beta-induced transcription.. Nature 394: 909 — 913.  PubMed DOI:10.1038/29814
  • Lebrun J.J., Takabe K., Chen Y., Vale W. (1999). Roles of pathway-specific and inhibitory Smads in activin receptor signaling.. Mol. Endocrinol. 13: 15 — 23.  PubMed DOI:10.1210/mend.13.1.0218

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]