JUN

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
JUN
Ідентифікатори
Символи AP1JUNproto-oncogene c-Junjun oncogenep39proto-oncogene cJunv-jun avian sarcoma virus 17 oncogene homologv-jun sarcoma virus 17 oncogene homologJun activation domain binding proteintranscription factor AP-1activator protein 1enhancer-binding protein AP1
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE JUN 201464 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

JUN (англ. Jun proto-oncogene, AP-1 transcription factor subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 331 амінокислот, а молекулярна маса — 35 676[2].

Послідовність амінокислот
1020304050
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLK
PHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCP
KNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASV
AGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQ
PQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQ
ERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Hattori K., Angel P., le Beau M.M., Karin M. (1988). Structure and chromosomal localization of the functional intronless human JUN protooncogene.. Proc. Natl. Acad. Sci. U.S.A. 85: 9148 — 9152.  PubMed DOI:10.1073/pnas.85.23.9148
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bannister A.J., Gottlieb T.M., Kouzarides T., Jackson S.P. (1993). c-Jun is phosphorylated by the DNA-dependent protein kinase in vitro; definition of the minimal kinase recognition motif.. Nucleic Acids Res. 21: 1289 — 1295.  PubMed DOI:10.1093/nar/21.5.1289
  • Enslen H., Tokumitsu H., Stork P.J., Davis R.J., Soderling T.R. (1996). Regulation of mitogen-activated protein kinases by a calcium/calmodulin-dependent protein kinase cascade.. Proc. Natl. Acad. Sci. U.S.A. 93: 10803 — 10808.  PubMed DOI:10.1073/pnas.93.20.10803
  • Kirstein M., Sanz L., Moscat J., Diaz-Meco M.T., Saus J. (1996). Cross-talk between different enhancer elements during mitogenic induction of the human stromelysin-1 gene.. J. Biol. Chem. 271: 18231 — 18236.  PubMed DOI:10.1074/jbc.271.30.18231
  • Claret F.-X., Hibi M., Dhut S., Toda T., Karin M. (1996). A new group of conserved coactivators that increase the specificity of AP-1 transcription factors.. Nature 383: 453 — 457.  PubMed DOI:10.1038/383453a0

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:6204 (англ.). Процитовано 25 серпня 2017. 
  2. UniProt, P05412 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]