ETS2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ETS2
Protein ETS2 PDB 1k78.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ETS2, ETS2IT1, ETS proto-oncogene 2, transcription factor
Зовнішні ІД OMIM: 164740 MGI: 95456 HomoloGene: 3838 GeneCards: ETS2
Шаблон експресії
PBB GE ETS2 201329 s at fs.png

PBB GE ETS2 201328 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001256295
NM_005239
NM_011809
RefSeq (білок)
NP_001243224
NP_005230
NP_035939
Локус (UCSC) Хр. 21: 38.81 – 38.82 Mb Хр. 16: 95.7 – 95.72 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ETS2 (англ. ETS proto-oncogene 2, transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 21-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 469 амінокислот, а молекулярна маса — 53 001[4].

Послідовність амінокислот
1020304050
MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQ
EVPTGLDSISHDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIP
KNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLEL
APDFVGDILWEHLEQMIKENQEKTEDQYEENSHLTSVPHWINSNTLGFGT
EQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVT
YCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQS
SLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIP
AAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVA
RRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVCDLQNLL
GFTPEELHAILGVQPDTED

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Wasylyk C., Schlumberger S.E., Criqui-Filipe P., Wasylyk B. (2002). Sp100 interacts with ETS-1 and stimulates its transcriptional activity.. Mol. Cell. Biol. 22: 2687 — 2702.  PubMed DOI:10.1128/MCB.22.8.2687-2702.2002
  • Watson D.K., Mavrothalassitis G.J., Jorcyk C.L., Smyth F.E., Papas T.S. (1990). Molecular organization and differential polyadenylation sites of the human ETS2 gene.. Oncogene 5: 1521 — 1527.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3489 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P15036 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]