IRF2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
IRF2
Protein IRF2 PDB 1irf.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IRF2, IRF-2, interferon regulatory factor 2
Зовнішні ІД OMIM: 147576 MGI: 96591 HomoloGene: 1659 GeneCards: IRF2
Шаблон експресії
PBB GE IRF2 203275 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002199
NM_008391
RefSeq (білок)
NP_002190
NP_032417
Локус (UCSC) Хр. 4: 184.39 – 184.47 Mb Хр. 8: 46.74 – 46.85 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IRF2 (англ. Interferon regulatory factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 349 амінокислот, а молекулярна маса — 39 354[4].

Послідовність амінокислот
1020304050
MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEK
DAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIK
KGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNG
VSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDIC
QVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRP
HWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVP
YNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Itoh S., Harada H., Fujita T., Mimura T., Taniguchi T. (1989). Sequence of a cDNA coding for human IRF-2.. Nucleic Acids Res. 17: 8372 — 8372.  PubMed DOI:10.1093/nar/17.20.8372
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Staal A., Enserink J.M., Stein J.L., Stein G.S., van Wijnen A.J. (2000). Molecular characterization of celtix-1, a bromodomain protein interacting with the transcription factor interferon regulatory factor 2.. J. Cell. Physiol. 185: 269 — 279.  PubMed DOI:10.1002/1097-4652(200011)185:2<269::AID-JCP12>3.0.CO;2-L
  • Masumi A., Yamakawa Y., Fukazawa H., Ozato K., Komuro K. (2003). Interferon regulatory factor-2 regulates cell growth through its acetylation.. J. Biol. Chem. 278: 25401 — 25407.  PubMed DOI:10.1074/jbc.M213037200
  • Childs K.S., Goodbourn S. (2003). Identification of novel co-repressor molecules for interferon regulatory factor-2.. Nucleic Acids Res. 31: 3016 — 3026.  PubMed DOI:10.1093/nar/gkg431
  • Han K.-J., Jiang L., Shu H.-B. (2008). Regulation of IRF2 transcriptional activity by its sumoylation.. Biochem. Biophys. Res. Commun. 372: 772 — 778.  PubMed DOI:10.1016/j.bbrc.2008.05.103

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6117 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, P14316 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]