GTF2H2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GTF2H2
Protein GTF2H2 PDB 1z60.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GTF2H2, BTF2, BTF2P44, T-BTF2P44, TFIIH, p44, general transcription factor IIH subunit 2
Зовнішні ІД OMIM: 601748 MGI: 1345669 HomoloGene: 1159 GeneCards: GTF2H2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001515
NM_022011
NM_001360706
RefSeq (білок)
NP_071294
NP_001347635
Локус (UCSC) Хр. 5: 71.03 – 71.07 Mb Хр. 13: 100.46 – 100.49 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GTF2H2 (англ. General transcription factor IIH subunit 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 395 амінокислот, а молекулярна маса — 44 419[4].

Послідовність амінокислот
1020304050
MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHH
GQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNP
ISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLS
IAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIG
LSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLI
RMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQG
ELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, пошкодження ДНК, репарація ДНК, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kershnar E., Wu S.-Y., Chiang C.-M. (1998). Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes.. J. Biol. Chem. 273: 34444 — 34453.  PubMed DOI:10.1074/jbc.273.51.34444
  • Tremeau-Bravard A., Perez C., Egly J.-M. (2001). A role of the C-terminal part of p44 in the promoter escape activity of transcription factor IIH.. J. Biol. Chem. 276: 27693 — 27697.  PubMed DOI:10.1074/jbc.M102457200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4656 (англ.). Процитовано 31 серпня 2017. 
  4. UniProt, Q13888 (англ.). Процитовано 31 серпня 2017. 

Див. також[ред. | ред. код]