ZNF451

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF451
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ZNF451, COASTER, dJ417I1.1, zinc finger protein 451
Зовнішні ІД OMIM: 615708 MGI: 2137896 HomoloGene: 9188 GeneCards: ZNF451
Шаблон експресії
PBB GE ZNF451 212557 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001031623
NM_001257273
NM_015555
NM_001290699
NM_001290700
NM_133817
NM_001359274
NM_001359275
RefSeq (білок)
NP_001026794
NP_001244202
NP_056370
NP_001277628
NP_001277629
NP_598578
NP_001346203
NP_001346204
Локус (UCSC) Хр. 6: 57.09 – 57.17 Mb Хр. 1: 33.76 – 33.81 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF451 (англ. Zinc finger protein 451) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 061 амінокислот, а молекулярна маса — 121 484[4].

Послідовність амінокислот
1020304050
MGDPGSEIIESVPPAGPEASESTTDENEDDIQFVSEGPLRPVLEYIDLVS
SDDEEPSTSYTDENIKRKDHIDYQKDKVALTLARLARHVEVEKQQKEEKN
RAFREKIDFQHAHGLQELEFIRGHSDTEAARLCVDQWLKMPGLKTGTINC
GTKSSFRRGGHTWVSGKPILCPIMHCNKEFDNGHLLLGHLKRFDHSPCDP
TITLHGPFFSSFACVVCYKKFVTQQQYRDHLFDKEATDDGHNNNLLPQII
QCFACPNCFLLFSRKEECSKHMSGKNHFHQSFKLGDNKGIAHPISFPSFA
KKLLISLCKDVPFQVKCVACHKTLRSHMELTAHFRVHCRNAGPVAVAEKS
ITQVAEKFILRGYCPDCNQVFVDETSTQNHKQNSGHKVRVINSVEESVLL
YCHSSEGNKDPSSDLHLLLDQSKFSSLKRTMSIKESSSLECIAIPKKKMN
LKDKSHEGVACVQKEKSVVKTWFCECNQRFPSEDAVEKHVFSANTMGYKC
VVCGKVCDDSGVIRLHMSRIHGGAHLNNFLFWCRTCKKELTRKDTIMAHV
TEFHNGHRYFYEMDEVEGETLPSSSTTLDNLTANKPSSAITVIDHSPANS
SPRGKWQCRICEDMFDSQEYVKQHCMSLASHKFHRYSCAHCRKPFHKIET
LYRHCQDEHDNEIKIKYFCGLCDLIFNVEEAFLSHYEEHHSIDYVFVSEK
TETSIKTEDDFPVIETSNQLTCGCRESYICKVNRKEDYSRCLQIMLDKGK
LWFRCSLCSATAQNLTDMNTHIHQVHKEKSDEEEQQYVIKCGTCTKAFHD
PESAQQHFHRKHCFLQKPSVAHFGSEKSNLYKFTASASHTERKLKQAINY
SKSLDMEKGVENDLSYQNIEEEIVELPDLDYLRTMTHIVFVDFDNWSNFF
GHLPGHLNQGTFIWGFQGGNTNWKPPLNCKIYNYLNRIGCFFLHPRCSKR
KDAADFAICMHAGRLDEQLPKQIPFTILSGDQGFLELENQFKKTQRPAHI
LNPHHLEGDMMCALLNSISDTTKECDSDDNMGAKNTSIGEEFISTEDVEL
EEAIRRSLEEM

Кодований геном білок за функціями належить до лігаз, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, убіквітинування білків, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Karvonen U., Jaeaeskelaeinen T., Rytinki M., Kaikkonen S., Palvimo J.J. (2008). ZNF451 is a novel PML body- and SUMO-associated transcriptional coregulator.. J. Mol. Biol. 382: 585 — 600.  PubMed DOI:10.1016/j.jmb.2008.07.016
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033
  • Cappadocia L., Pichler A., Lima C.D. (2015). Structural basis for catalytic activation by the human ZNF451 SUMO E3 ligase.. Nat. Struct. Mol. Biol. 22: 968 — 975.  PubMed DOI:10.1038/nsmb.3116

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:21091 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q9Y4E5 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]