IRF3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
IRF3
Protein IRF3 PDB 1j2f.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IRF3, entrez:3661, IIAE7, interferon regulatory factor 3
Зовнішні ІД OMIM: 603734 MGI: 1859179 HomoloGene: 1208 GeneCards: IRF3
Шаблон експресії
PBB GE IRF3 202621 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_016849
RefSeq (білок)
NP_058545
Локус (UCSC) Хр. 19: 49.66 – 49.67 Mb Хр. 7: 45 – 45 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IRF3 (англ. Interferon regulatory factor 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 427 амінокислот, а молекулярна маса — 47 219[4].

Послідовність амінокислот
1020304050
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQED
FGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDP
HDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLA
PLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGE
EWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGM
SLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELL
PNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGE
SWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHP
LSLTSDQYKAYLQDLVEGMDFQGPGES

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як імунітет, вроджений імунітет, взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, противірусний захист, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Au W.W.-C., Moore P.P.A., Lowther W.W., Juang Y.-T., Pitha P.M. (1995). Identification of a member of the interferon regulatory factor family that binds to the interferon-stimulated response element and activates expression of interferon-induced genes.. Proc. Natl. Acad. Sci. U.S.A. 92: 11657 — 11661.  PubMed DOI:10.1073/pnas.92.25.11657
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bellingham J., Gregory-Evans K., Gregory-Evans C.Y. (1998). Mapping of human interferon regulatory factor 3 (IRF3) to chromosome 19q13.3-13.4 by an intragenic polymorphic marker.. Ann. Hum. Genet. 62: 231 — 234.  PubMed DOI:10.1046/j.1469-1809.1998.6230231.x
  • Lin R., Heylbroeck C., Pitha P.M., Hiscott J. (1998). Virus-dependent phosphorylation of the IRF-3 transcription factor regulates nuclear translocation, transactivation potential, and proteasome-mediated degradation.. Mol. Cell. Biol. 18: 2986 — 2996.  PubMed DOI:10.1128/MCB.18.5.2986
  • Kumar K.P., McBride K.M., Weaver B.K., Dingwall C., Reich N.C. (2000). Regulated nuclear-cytoplasmic localization of interferon regulatory factor 3, a subunit of double-stranded RNA-activated factor 1.. Mol. Cell. Biol. 20: 4159 — 4168.  PubMed DOI:10.1128/MCB.20.11.4159-4168.2000
  • Smith E.J., Marie I.J., Prakash A., Garcia-Sastre A., Levy D.E. (2001). IRF3 and IRF7 phosphorylation in virus-infected cells does not require double-stranded RNA-dependent protein kinase R or Ikappa B kinase but is blocked by Vaccinia virus E3L protein.. J. Biol. Chem. 276: 8951 — 8957.  PubMed DOI:10.1074/jbc.M008717200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6118 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q14653 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]