CEBPG

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CEBPG
Ідентифікатори
Символи CEBPG, GPE1BP, IG/EBP-1, CCAAT/enhancer binding protein gamma, CCAAT enhancer binding protein gamma
Зовнішні ІД OMIM: 138972 MGI: 104982 HomoloGene: 1368 GeneCards: CEBPG
Шаблон експресії
PBB GE CEBPG 204203 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001806
NM_001252296
NM_009884
RefSeq (білок)
NP_001239225
NP_001797
NP_034014
Локус (UCSC) Хр. 19: 33.37 – 33.38 Mb Хр. 7: 35.05 – 35.06 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CEBPG (англ. CCAAT/enhancer binding protein gamma) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 150 амінокислот, а молекулярна маса — 16 408[4].

Послідовність амінокислот
1020304050
MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSK
QSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEE
NERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Davydov I.V., Bohmann D., Krammer P.H., Li-Weber M. (1995). Cloning of the cDNA encoding human C/EBP gamma, a protein binding to the PRE-I enhancer element of the human interleukin-4 promoter.. Gene 161: 271 — 275.  PubMed DOI:10.1016/0378-1119(95)00271-7
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1837 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P53567 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]