MXD3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MXD3
Ідентифікатори
Символи MXD3, BHLHC13, MAD3, MYX, MAX dimerization protein 3
Зовнішні ІД OMIM: 609450 MGI: 104987 HomoloGene: 32333 GeneCards: MXD3
Пов'язані генетичні захворювання
Ожиріння[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_031300
NM_001142935
NM_016662
RefSeq (білок)
NP_001136407
NP_112590
NP_112590.1
NP_057871
Локус (UCSC) Хр. 5: 177.3 – 177.31 Mb Хр. 13: 55.33 – 55.33 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MXD3 (англ. MAX dimerization protein 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 206 амінокислот, а молекулярна маса — 23 477[5].

Послідовність амінокислот
1020304050
MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQ
APGAQDSGRSVHNELEKRRRAQLKRCLERLKQQMPLGADCARYTTLSLLR
RARMHIQKLEDQEQRARQLKERLRSKQQSLQRQLEQLRGLAGAAERERLR
ADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGFVAGQEHSYSH
GGGAWL

Кодований геном білок за функцією належить до репресорів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]