IFI16

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
IFI16
Protein IFI16 PDB 2oq0.png
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи IFI16, IFNGIP1, PYHIN2, interferon gamma inducible protein 16
Зовнішні ІД OMIM: 147586 MGI: 3695276 HomoloGene: 115929 GeneCards: IFI16
Пов'язані генетичні захворювання
Ревматоїдний артрит, Целіакія[1]
Шаблон експресії
PBB GE IFI16 208966 x at fs.png

PBB GE IFI16 208965 s at fs.png

PBB GE IFI16 206332 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001033384
NM_001177349
NM_001177350
NM_001368798
NM_001368799
RefSeq (білок)
н/д
Локус (UCSC) Хр. 1: 159 – 159.06 Mb Хр. 1: 173.57 – 173.6 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IFI16 (англ. Interferon gamma inducible protein 16) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 785 амінокислот, а молекулярна маса — 88 256[5].

Послідовність амінокислот
1020304050
MGKKYKNIVLLKGLEVINDYHFRMVKSLLSNDLKLNLKMREEYDKIQIAD
LMEEKFRGDAGLGKLIKIFEDIPTLEDLAETLKKEKLKVKGPALSRKRKK
EVDATSPAPSTSSTVKTEGAEATPGAQKRKKSTKEKAGPKGSKVSEEQTQ
PPSPAGAGMSTAMGRSPSPKTSLSAPPNSSSTENPKTVAKCQVTPRRNVL
QKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLK
EKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKE
TLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQ
CHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIKKKTNPRNNDPK
SMKLPQEQRQLPYPSEASTTFPESHLRTPQMPPTTPSSSFFTKKSEDTIS
KMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPPSTPSSSFLTTK
SEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPPSTPSS
SFLTTLKPRLKTEPEEVSIEDSAQSDLKEVMVLNATESFVYEPKEQKKMF
HATVATENEVFRVKVFNIDLKEKFTPKKIIAIANYVCRNGFLEVYPFTLV
ADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRG
EFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGEL
RSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як апоптоз, імунітет, вроджений імунітет, транскрипція, регуляція транскрипції, запальна відповідь, автофагія, поліморфізм, ацетиляція. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Trapani J.A., Dawson M.J., Apostolidis V.A., Browne K.A. (1994). Genomic organization of IFI16, an interferon-inducible gene whose expression is associated with human myeloid cell differentiation: correlation of predicted protein domains with exon organization.. Immunogenetics 40: 415 — 424.  PubMed DOI:10.1007/BF00177824
  • Xin H., Curry J., Johnstone R.W., Nickoloff B.J., Choubey D. (2003). Role of IFI 16, a member of the interferon-inducible p200-protein family, in prostate epithelial cellular senescence.. Oncogene 22: 4831 — 4840.  PubMed DOI:10.1038/sj.onc.1206754
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Johnstone R.W., Kershaw M.H., Trapani J.A. (1998). Isotypic variants of the interferon-inducible transcriptional repressor IFI 16 arise through differential mRNA splicing.. Biochemistry 37: 11924 — 11931.  PubMed DOI:10.1021/bi981069a
  • Dawson M.J., Trapani J.A. (1995). IFI 16 gene encodes a nuclear protein whose expression is induced by interferons in human myeloid leukaemia cell lines.. J. Cell. Biochem. 57: 39 — 51.  PubMed DOI:10.1002/jcb.240570106
  • Johnstone R.W., Kerry J.A., Trapani J.A. (1998). The human interferon-inducible protein, IFI 16, is a repressor of transcription.. J. Biol. Chem. 273: 17172 — 17177.  PubMed DOI:10.1074/jbc.273.27.17172

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]