CEBPE

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CEBPE
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CEBPE, C/EBP-epsilon, CRP1, CCAAT/enhancer binding protein epsilon, CCAAT enhancer binding protein epsilon
Зовнішні ІД OMIM: 600749 MGI: 103572 HomoloGene: 1367 GeneCards: CEBPE
Пов'язані генетичні захворювання
Гострий лімфобластний лейкоз, lymphoblastic leukemia[1]
Шаблон експресії
PBB GE CEBPE 214523 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001805
NM_207131
RefSeq (білок)
NP_001796
NP_997014
Локус (UCSC) Хр. 14: 23.12 – 23.12 Mb Хр. 14: 54.71 – 54.71 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CEBPE (англ. CCAAT/enhancer binding protein epsilon) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 281 амінокислот, а молекулярна маса — 30 603[5].

Послідовність амінокислот
1020304050
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGE
EQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRK
ALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQ
TAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAV
NKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRV
EQLTQELDTLRNLFRQIPEAANLIKGVGGCS

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Antonson P., Stellan B., Yamanaka R., Xanthopoulos K.G. (1996). A novel human CCAAT/enhancer binding protein gene, C/EBPepsilon, is expressed in cells of lymphoid and myeloid lineages and is localized on chromosome 14q11.2 close to the T-cell receptor alpha/delta locus.. Genomics 35: 30 — 38.  PubMed DOI:10.1006/geno.1996.0319
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]