SREBF2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SREBF2
Protein SREBF2 PDB 1ukl.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SREBF2, SREBP-2, SREBP2, bHLHd2, sterol regulatory element binding transcription factor 2
Зовнішні ІД OMIM: 600481 MGI: 107585 HomoloGene: 20966 GeneCards: SREBF2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004599
NM_033218
RefSeq (білок)
NP_004590
NP_150087
Локус (UCSC) Хр. 22: 41.83 – 41.91 Mb Хр. 15: 82.15 – 82.21 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SREBF2 (англ. Sterol regulatory element binding transcription factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 141 амінокислот, а молекулярна маса — 123 688[4].

Послідовність амінокислот
1020304050
MDDSGELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQL
CSSFPGSGGSGSSSGSSGSSSSSSNGRGSSSGAVDPSVQRSFTQVTLPSF
SPSAASPQAPTLQVKVSPTSVPTTPRATPILQPRPQPQPQPQTQLQQQTV
MITPTFSTTPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTSSQVQPVTIQ
QQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQIIKT
DSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSSGTILT
TMPVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKI
IELKDLVMGTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQK
NKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSID
SEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILLCVLTFLCLSFNPLTSL
LQWGGAHDSDQHPHSGSGRSVLSFESGSGGWFDWMMPTLLLWLVNGVIVL
SVFVKLLVHGEPVIRPHSRSSVTFWRHRKQADLDLARGDFAAAAGNLQTC
LAVLGRALPTSRLDLACSLSWNVIRYSLQKLRLVRWLLKKVFQCRRATPA
TEAGFEDEAKTSARDAALAYHRLHQLHITGKLPAGSACSDVHMALCAVNL
AECAEEKIPPSTLVEIHLTAAMGLKTRCGGKLGFLASYFLSRAQSLCGPE
HSAVPDSLRWLCHPLGQKFFMERSWSVKSAAKESLYCAQRNPADPIAQVH
QAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDS
VGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT
KVERIPKALEVTESPLVKAIFHACRAMHASLPGKADGQQSSFCHCERASG
HLWSSLNVSGATSDPALNHVVQLLTCDLLLSLRTALWQKQASASQAVGET
YHASGAELAGFQRDLGSLRRLAHSFRPAYRKVFLHEATVRLMAGASPTRT
HQLLEHSLRRRTTQSTKHGEVDAWPGQRERATAILLACRHLPLSFLSSPG
QRAVLLAEAARTLEKVGDRRSCNDCQQMIVKLGGGTAIAAS

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, метаболізм ліпідів, метаболізм холестеролу, метаболізм стероїдів, метаболізм стеролів, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, мембрані, ендоплазматичному ретикулумі, цитоплазматичних везикулах, апараті гольджі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hua X., Sakai J., Brown M.S., Goldstein J.L. (1996). Regulated cleavage of sterol regulatory element binding proteins requires sequences on both sides of the endoplasmic reticulum membrane.. J. Biol. Chem. 271: 10379 — 10384.  PubMed DOI:10.1074/jbc.271.17.10379
  • Pai J.-T., Brown M.S., Goldstein J.L. (1996). Purification and cDNA cloning of a second apoptosis-related cysteine protease that cleaves and activates sterol regulatory element binding proteins.. Proc. Natl. Acad. Sci. U.S.A. 93: 5437 — 5442.  PubMed DOI:10.1073/pnas.93.11.5437
  • Duncan E.A., Dave U.P., Sakai J., Goldstein J.L., Brown M.S. (1998). Second-site cleavage in sterol regulatory element-binding protein occurs at transmembrane junction as determined by cysteine panning.. J. Biol. Chem. 273: 17801 — 17809.  PubMed DOI:10.1074/jbc.273.28.17801
  • Ye J., Dave U.P., Grishin N.V., Goldstein J.L., Brown M.S. (2000). Asparagine-proline sequence within membrane-spanning segment of SREBP triggers intramembrane cleavage by site-2 protease.. Proc. Natl. Acad. Sci. U.S.A. 97: 5123 — 5128.  PubMed DOI:10.1073/pnas.97.10.5123
  • Irisawa M., Inoue J., Ozawa N., Mori K., Sato R. (2009). The sterol-sensing endoplasmic reticulum (ER) membrane protein TRC8 hampers ER to Golgi transport of sterol regulatory element-binding protein-2 (SREBP-2)/SREBP cleavage-activated protein and reduces SREBP-2 cleavage.. J. Biol. Chem. 284: 28995 — 29004.  PubMed DOI:10.1074/jbc.M109.041376

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11290 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q12772 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]