KDM5C

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KDM5C
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KDM5C, DXS1272E, JARID1C, MRX13, MRXJ, MRXSCJ, MRXSJ, SMCX, XE169, lysine demethylase 5C
Зовнішні ІД OMIM: 314690 MGI: 99781 HomoloGene: 79498 GeneCards: KDM5C
Пов'язані генетичні захворювання
syndromic X-linked intellectual disability Claes-Jensen type, X-linked mental retardation[1]
Шаблон експресії
PBB GE JARID1C 202383 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_013668
RefSeq (білок)
NP_038696
Локус (UCSC) Хр. X: 53.19 – 53.23 Mb Хр. X: 152.23 – 152.27 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KDM5C (англ. Lysine demethylase 5C) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[4] Довжина поліпептидного ланцюга білка становить 1 560 амінокислот, а молекулярна маса — 175 720[5].

Послідовність амінокислот
1020304050
MEPGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPA
DWQPPFAVEVDNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSL
KIPNVERRILDLYSLSKIVVEEGGYEAICKDRRWARVAQRLNYPPGKNIG
SLLRSHYERIVYPYEMYQSGANLVQCNTRPFDNEEKDKEYKPHSIPLRQS
VQPSKFNSYGRRAKRLQPDPEPTEEDIEKNPELKKLQIYGAGPKMMGLGL
MAKDKTLRKKDKEGPECPPTVVVKEELGGDVKVESTSPKTFLESKEELSH
SPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRGDEDDKLLLCDGCDDNYH
IFCLLPPLPEIPKGVWRCPKCVMAECKRPPEAFGFEQATREYTLQSFGEM
ADSFKADYFNMPVHMVPTELVEKEFWRLVNSIEEDVTVEYGADIHSKEFG
SGFPVSDSKRHLTPEEEEYATSGWNLNVMPVLEQSVLCHINADISGMKVP
WLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMK
KLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRA
YHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICK
MAACPEKLDLNLAAAVHKEMFIMVQEERRLRKALLEKGITEAEREAFELL
PDDERQCIKCKTTCFLSALACYDCPDGLVCLSHINDLCKCSSSRQYLRYR
YTLDELPAMLHKLKVRAESFDTWANKVRVALEVEDGRKRSLEELRALESE
ARERRFPNSELLQQLKNCLSEAEACVSRALGLVSGQEAGPHRVAGLQMTL
TELRAFLDQMNNLPCAMHQIGDVKGVLEQVEAYQAEAREALASLPSSPGL
LQSLLERGRQLGVEVPEAQQLQRQVEQARWLDEVKRTLAPSARRGTLAVM
RGLLVAGASVAPSPAVDKAQAELQELLTIAERWEEKAHLCLEARQKHPPA
TLEAIIREAENIPVHLPNIQALKEALAKARAWIADVDEIQNGDHYPCLDD
LEGLVAVGRDLPVGLEELRQLELQVLTAHSWREKASKTFLKKNSCYTLLE
VLCPCADAGSDSTKRSRWMEKELGLYKSDTELLGLSAQDLRDPGSVIVAF
KEGEQKEKEGILQLRRTNSAKPSPLASSSTASSTTSICVCGQVLAGAGAL
QCDLCQDWFHGRCVSVPRLLSSPRPNPTSSPLLAWWEWDTKFLCPLCMRS
RRPRLETILALLVALQRLPVRLPEGEALQCLTERAISWQGRARQALASED
VTALLGRLAELRQRLQAEPRPEEPPNYPAAPASDPLREGSGKDMPKVQGL
LENGDSVTSPEKVAPEEGSGKRDLELLSSLLPQLTGPVLELPEATRAPLE
ELMMEGDLLEVTLDENHSIWQLLQAGQPPDLERIRTLLELEKAERHGSRA
RGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEE
ETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLHLP
CPQQPPQQQL

Кодований геном білок за функціями належить до оксидоредуктаз, репресорів, регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, іоном заліза. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]