ESR2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ESR2
Protein ESR2 PDB 1hj1.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ESR2, ER-BETA, ESR-BETA, ESRB, ESTRB, Erb, NR3A2, estrogen receptor 2, ODG8
Зовнішні ІД OMIM: 601663 MGI: 109392 HomoloGene: 1100 GeneCards: ESR2
Реагує на сполуку
Естрадіол, diethylstilbestrol, estriol, estrone, ethinylestradiol, Геністейн, Тамоксифен, Бісфенол А, lasofoxifene, bazedoxifene, raloxifene[1]
Шаблон експресії
PBB GE ESR2 211120 x at fs.png

PBB GE ESR2 211118 x at fs.png

PBB GE ESR2 211117 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_010157
NM_207707
RefSeq (білок)
NP_034287
NP_997590
Локус (UCSC) Хр. 14: 64.08 – 64.34 Mb Хр. 12: 76.12 – 76.18 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ESR2 (англ. Estrogen receptor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 530 амінокислот, а молекулярна маса — 59 216[5].

Послідовність амінокислот
1020304050
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYS
PAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYA
EPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCA
VCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKS
CQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGG
HAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDH
PGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCV
KAMILLNSSMYPLVTATQDADSSRKLAHLLNAVTDALVWVIAKSGISSQQ
QSMRLANLLMLLSHVRHASNKGMEHLLNMKCKNVVPVYDLLLEMLNAHVL
RGCKSSITGSECSPAEDSKSKEGSQNPQSQ

Кодований геном білок за функціями належить до рецепторів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ліпідами, іонами металів, іоном цинку, ДНК, стероїдами. Локалізований у ядрі.

Література[ред. | ред. код]

  • Leung Y.K., Mak P., Hassan S., Ho S.M. (2006). Estrogen receptor (ER)-beta isoforms: a key to understanding ER-beta signaling.. Proc. Natl. Acad. Sci. U.S.A. 103: 13162 — 13167.  PubMed DOI:10.1073/pnas.0605676103
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Li L.C., Yeh C.C., Nojima D., Dahiya R. (2000). Cloning and characterization of human estrogen receptor beta promoter.. Biochem. Biophys. Res. Commun. 275: 682 — 689.  PubMed DOI:10.1006/bbrc.2000.3363
  • Mosselman S., Polman J., Dijkema R. (1996). ER beta: identification and characterization of a novel human estrogen receptor.. FEBS Lett. 392: 49 — 53.  PubMed DOI:10.1016/0014-5793(96)00782-X
  • Pace P., Taylor J., Suntharalingam S., Coombes R.C., Ali S. (1997). Human estrogen receptor beta binds DNA in a manner similar to and dimerizes with estrogen receptor alpha.. J. Biol. Chem. 272: 25832 — 25838.  PubMed DOI:10.1074/jbc.272.41.25832
  • Caira F., Antonson P., Pelto-Huikko M., Treuter E., Gustafsson J.-A. (2000). Cloning and characterization of RAP250, a nuclear receptor coactivator.. J. Biol. Chem. 275: 5308 — 5317.  PubMed DOI:10.1074/jbc.275.8.5308

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]