GABPA

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GABPA
Protein GABPA PDB 1awc.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GABPA, E4TF1-60, E4TF1A, NFT2, NRF2, NRF2A, RCH04A07, GA binding protein transcription factor alpha subunit, GA binding protein transcription factor subunit alpha
Зовнішні ІД OMIM: 600609 MGI: 95610 HomoloGene: 1543 GeneCards: GABPA
Шаблон експресії
PBB GE GABPA 210188 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001197297
NM_002040
NM_008065
RefSeq (білок)
NP_001184226
NP_002031
NP_002031.2
NP_032091
Локус (UCSC) Хр. 21: 25.73 – 25.77 Mb Хр. 16: 84.83 – 84.86 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GABPA (англ. GA binding protein transcription factor alpha subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 21-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 454 амінокислот, а молекулярна маса — 51 295[4].

Послідовність амінокислот
1020304050
MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGN
LKKLLEPRLQCSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVIS
YQGIEPKLNILEIVKPADTVEVVIDPDAHHAESEAHLVEEAQVITLDGTK
HITTISDETSEQVTRWAAALEGYRKEQERLGIPYDPIQWSTDQVLHWVVW
VMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEILWSHLELLRKY
VLASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKAAKVQRAP
RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKL
NQPELVAQKWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFV
CDLKTLIGYSAAELNRLVTECEQKKLAKMQLHGIAQPVTAVALATASLQT
EKDN

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Gugneja S., Virbasius J.V., Scarpulla R.C. (1995). Four structurally distinct, non-DNA-binding subunits of human nuclear respiratory factor 2 share a conserved transcriptional activation domain.. Mol. Cell. Biol. 15: 102 — 111.  PubMed DOI:10.1128/MCB.15.1.102

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4071 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q06546 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]