ZNF10

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF10
Ідентифікатори
Символи ZNF10, KOX1, zinc finger protein 10
Зовнішні ІД OMIM: 194538 HomoloGene: 130674 GeneCards: ZNF10
Шаблон експресії
PBB GE ZNF10 216350 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_015394
н/д
RefSeq (білок)
NP_056209
н/д
Локус (UCSC) Хр. 12: 133.13 – 133.16 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

ZNF10 (англ. Zinc finger protein 10) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 573 амінокислот, а молекулярна маса — 66 455[3].

Послідовність амінокислот
1020304050
MDAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNL
VSLGYQLTKPDVILRLEKGEEPWLVEREIHQETHPDSETAFEIKSSVSSR
SIFKDKQSCDIKMEGMARNDLWYLSLEEVWKCRDQLDKYQENPERHLRQV
AFTQKKVLTQERVSESGKYGGNCLLPAQLVLREYFHKRDSHTKSLKHDLV
LNGHQDSCASNSNECGQTFCQNIHLIQFARTHTGDKSYKCPDNDNSLTHG
SSLGISKGIHREKPYECKECGKFFSWRSNLTRHQLIHTGEKPYECKECGK
SFSRSSHLIGHQKTHTGEEPYECKECGKSFSWFSHLVTHQRTHTGDKLYT
CNQCGKSFVHSSRLIRHQRTHTGEKPYECPECGKSFRQSTHLILHQRTHV
RVRPYECNECGKSYSQRSHLVVHHRIHTGLKPFECKDCGKCFSRSSHLYS
HQRTHTGEKPYECHDCGKSFSQSSALIVHQRIHTGEKPYECCQCGKAFIR
KNDLIKHQRIHVGEETYKCNQCGIIFSQNSPFIVHQIAHTGEQFLTCNQC
GTALVNTSNLIGYQTNHIRENAY

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Thiesen H.-J. (1990). Multiple genes encoding zinc finger domains are expressed in human T cells.. New Biol. 2: 363 — 374.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:12879 (англ.). Процитовано 11 вересня 2017. 
  3. UniProt, P21506 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]