DIDO1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DIDO1
Protein DIDO1 PDB 1wem.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи DIDO1, BYE1, C20orf158, DATF-1, DATF1, DIDO2, DIDO3, DIO-1, DIO1, dJ885L7.8, death inducer-obliterator 1
Зовнішні ІД OMIM: 604140 MGI: 1344352 HomoloGene: 34139 GeneCards: DIDO1
Шаблон експресії
PBB GE DIDO1 218325 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001291432
NM_001291433
NM_011805
NM_175551
NM_177852
RefSeq (білок)
NP_001278361
NP_001278362
NP_035935
NP_780760
NP_808520
Локус (UCSC) Хр. 20: 62.88 – 62.94 Mb Хр. 2: 180.66 – 180.71 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

DIDO1 (англ. Death inducer-obliterator 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 2 240 амінокислот, а молекулярна маса — 243 873[4].

Послідовність амінокислот
1020304050
MDDKGDPSNEEAPKAIKPTSKEFRKTWGFRRTTIAKREGAGDAEADPLEP
PPPQQQLGLSLRRSGRQPKRTERVEQFLTIARRRGRRSMPVSLEDSGEPT
SCPATDAETASEGSVESASETRSGPQSASTAVKERPASSEKVKGGDDHDD
TSDSDSDGLTLKELQNRLRRKREQEPTERPLKGIQSRLRKKRREEGPAET
VGSEASDTVEGVLPSKQEPENDQGVVSQAGKDDRESKLEGKAAQDIKDEE
PGDLGRPKPECEGYDPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGIS
EARGRLLERNGEDYICPNCTILQVQDETHSETADQQEAKWRPGDADGTDC
TSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGP
GCCHVAQPDSVYCSNDCILKHAAATMKFLSSGKEQKPKPKEKMKMKPEKP
SLPKCGAQAGIKISSVHKRPAPEKKETTVKKAVVVPARSEALGKEAACES
STPSWASDHNYNAVKPEKTAAPSPSLLYKSTKEDRRSEEKAAAMAASKKT
APPGSAVGKQPAPRNLVPKKSSFANVAAATPAIKKPPSGFKGTIPKRPWL
SATPSSGASAARQAGPAPAAATAASKKFPGSAALVGAVRKPVVPSVPMAS
PAPGRLGAMSAAPSQPNSQIRQNIRRSLKEILWKRVNDSDDLIMTENEVG
KIALHIEKEMFNLFQVTDNRYKSKYRSIMFNLKDPKNQGLFHRVLREEIS
LAKLVRLKPEELVSKELSTWKERPARSVMESRTKLHNESKKTAPRQEAIP
DLEDSPPVSDSEEQQESARAVPEKSTAPLLDVFSSMLKDTTSQHRAHLFD
LNCKICTGQVPSAEDEPAPKKQKLSASVKKEDLKSKHDSSAPDPAPDSAD
EVMPEAVPEVASEPGLESASHPNVDRTYFPGPPGDGHPEPSPLEDLSPCP
ASCGSGVVTTVTVSGRDPRTAPSSSCTAVASAASRPDSTHMVEARQDVPK
PVLTSVMVPKSILAKPSSSPDPRYLSVPPSPNISTSESRSPPEGDTTLFL
SRLSTIWKGFINMQSVAKFVTKAYPVSGCFDYLSEDLPDTIHIGGRIAPK
TVWDYVGKLKSSVSKELCLIRFHPATEEEEVAYISLYSYFSSRGRFGVVA
NNNRHVKDLYLIPLSAQDPVPSKLLPFEGPGLESPRPNIILGLVICQKIK
RPANSGELDKMDEKRTRLQPEEADVPAYPKVATVPQSEKKPSKYPLCSAD
AAVSTTPPGSPPPPPPLPEPPVLKVLSSLKPAAPSPATAATTAAAASTAA
SSTASSASKTASPLEHILQTLFGKKKSFDPSAREPPGSTAGLPQEPKTTA
EDGVPAPPLLDPIVQQFGQFSKDKALEEEEDDRPYDPEEEYDPERAFDTQ
LVERGRRHEVERAPEAAAAEREEVAYDPEDETILEEAKVTVDDLPNRMCA
DVRRNSVERPAEPVAGAATPSLVEQQKMLEELNKQIEEQKRQLEEQEEAL
RQQRAAVGVSMAHFSVSDALMSPPPKSSLPKAELFQQEQQSADKPASLPP
ASQASNHRDPRQARRLATETGEGEGEPLSRLSARGAQGALPERDASRGGL
VGQAPMPVPEEKEPASSPWASGEKPPAGSEQDGWKAEPGEGTRPATVGDS
SARPARRVLLPTPPCGALQPGFPLQHDGERDPFTCPGFASQDKALGSAQY
EDPRNLHSAGRSSSPAGETEGDREPQARPGEGTAPLPPPGQKVGGSQPPF
QGQREPGPHALGMSGLHGPNFPGPRGPAPPFPEENIASNDGPRGPPPARF
GAQKGPIPSLFSGQHGPPPYGDSRGPSPSYLGGPRGVAPSQFEERKDPHG
EKREFQDAPYNEVTGAPAQFEGTEQAPFLGSRGGAPFQFGGQRRPLLSQL
KGPRGGPPPSQFGGQRGPPPGHFVGPRGPHPSQFETARGPHPNQFEGPRG
QAPNFMPGPRGIQPQQFEDQRVHSPPRFTNQRAPAPLQFGGLRGSAPFSE
KNEQTPSRFHFQGQAPQVMKPGPRPLLELPSHPPQHRKDRWEEAGPPSAL
SSSAPGQGPEADGQWASADFREGKGHEYRNQTFEGRQRERFDVGPKEKPL
EEPDAQGRASEDRRRERERGRNWSRERDWDRPREWDRHRDKDSSRDWDRN
RERSANRDREREADRGKEWDRSRERSRNRERERDRRRDRDRSRSRERDRD
KARDRERGRDRKDRSKSKESARDPKPEASRASDAGTASQA

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, цитоскелеті, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2680 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9BTC0 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]