NANOG

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NANOG
Ідентифікатори
Символи homeobox protein NANOGhNanoghomeobox transcription factor NanogNANOGhomeobox transcription factor Nanog-delta 48
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE NANOG 220184 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

NANOG (англ. Nanog homeobox) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 305 амінокислот, а молекулярна маса — 34 620[2].

Послідовність амінокислот
1020304050
MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTET
VSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRT
VFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKS
KRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQT
WNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQS
CMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNM
QPEDV

Кодований геном білок за функціями належить до репресорів, активаторів, білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Hart A.H., Hartley L., Ibrahim M., Robb L. (2004). Identification, cloning and expression analysis of the pluripotency promoting Nanog genes in mouse and human.. Dev. Dyn. 230: 187 — 198.  PubMed DOI:10.1002/dvdy.20034
  • Booth H.A., Holland P.W. (2004). Eleven daughters of NANOG.. Genomics 84: 229 — 238.  PubMed DOI:10.1016/j.ygeno.2004.02.014

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:20857 (англ.). Процитовано 11 вересня 2017. 
  2. UniProt, Q9H9S0 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]