NR1H4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR1H4
Protein NR1H4 PDB 1osh.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR1H4, BAR, FXR, HRR-1, HRR1, RIP14, nuclear receptor subfamily 1 group H member 4, PFIC5
Зовнішні ІД OMIM: 603826 MGI: 1352464 HomoloGene: 3760 GeneCards: NR1H4
Реагує на сполуку
chenodiol, fexaramine, obeticholic acid, (E)-guggulsterone[1]
Шаблон експресії
PBB GE NR1H4 206340 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001163504
NM_001163700
NM_009108
RefSeq (білок)
NP_001156976
NP_001157172
NP_033134
Локус (UCSC) Хр. 12: 100.47 – 100.56 Mb Хр. 10: 89.45 – 89.53 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR1H4 (англ. Nuclear receptor subfamily 1 group H member 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 486 амінокислот, а молекулярна маса — 55 914[5].

Послідовність амінокислот
1020304050
MVMQFQGLENPIQISPHCSCTPSGFFMEMMSMKPAKGVLTEQVAGPLGQN
LEVEPYSQYSNVQFPQVQPQISSSSYYSNLGFYPQQPEEWYSPGIYELRR
MPAETLYQGETEVAEMPVTKKPRMGASAGRIKGDELCVVCGDRASGYHYN
ALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQECRLRKCKEM
GMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTT
KSCREKTELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLI
LTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIF
NKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLT
AIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGR
LTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ

Кодований геном білок за функціями належить до репресорів, рецепторів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як імунітет, вроджений імунітет, транскрипція, регуляція транскрипції, запальна відповідь, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kanaya E., Shiraki T., Jingami H. (2004). The nuclear bile acid receptor FXR is activated by PGC-1alpha in a ligand-dependent manner.. Biochem. J. 382: 913 — 921.  PubMed DOI:10.1042/BJ20040432
  • Neimark E., Chen F., Li X., Shneider B.L. (2004). Bile acid-induced negative feedback regulation of the human ileal bile acid transporter.. Hepatology 40: 149 — 156.  PubMed DOI:10.1002/hep.20295
  • Pineda Torra I., Freedman L.P., Garabedian M.J. (2004). Identification of DRIP205 as a coactivator for the Farnesoid X receptor.. J. Biol. Chem. 279: 36184 — 36191.  PubMed DOI:10.1074/jbc.M405126200
  • Hirokane H., Nakahara M., Tachibana S., Shimizu M., Sato R. (2004). Bile acid reduces the secretion of very low density lipoprotein by repressing microsomal triglyceride transfer protein gene expression mediated by hepatocyte nuclear factor-4.. J. Biol. Chem. 279: 45685 — 45692.  PubMed DOI:10.1074/jbc.M404255200
  • Ananthanarayanan M., Li S., Balasubramaniyan N., Suchy F.J., Walsh M.J. (2004). Ligand-dependent activation of the farnesoid X-receptor directs arginine methylation of histone H3 by CARM1.. J. Biol. Chem. 279: 54348 — 54357.  PubMed DOI:10.1074/jbc.M410021200

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]