TFAP2C

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TFAP2C
Ідентифікатори
Символи TFAP2C, AP2-GAMMA, ERF1, TFAP2G, hAP-2g, transcription factor AP-2 gamma
Зовнішні ІД OMIM: 601602 MGI: 106032 HomoloGene: 2423 GeneCards: TFAP2C
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003222
NM_001159696
NM_009335
RefSeq (білок)
NP_003213
NP_001153168
NP_033361
Локус (UCSC) Хр. 20: 56.63 – 56.64 Mb Хр. 2: 172.55 – 172.56 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TFAP2C (англ. Transcription factor AP-2 gamma) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 450 амінокислот, а молекулярна маса — 49 177[4].

Послідовність амінокислот
1020304050
MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTG
VAEYQPPPYFPPPYQQLAYSQSADPYSHLGEAYAAAINPLHQPAPTGSQQ
QAWPGRQSQEGAGLPSHHGRPAGLLPHLSGLEAGAVSARRDAYRRSDLLL
PHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISM
TKNPLNLPCQKELVGAVMNPTEVFCSVPGRLSLLSSTSKYKVTVAEVQRR
LSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAAHVT
LLTSLVEGEAVHLARDFAYVCEAEFPSKPVAEYLTRPHLGGRNEMAARKN
MLLAAQQLCKEFTELLSQDRTPHGTSRLAPVLETNIQNCLSHFSLITHGF
GSQAICAAVSALQNYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • McPherson L.A., Baichwal V.R., Weigel R.J. (1997). Identification of ERF-1 as a member of the AP2 transcription factor family.. Proc. Natl. Acad. Sci. U.S.A. 94: 4342 — 4347.  PubMed DOI:10.1073/pnas.94.9.4342
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Eloranta J.J., Hurst H.C. (2002). Transcription factor AP-2 interacts with the SUMO-conjugating enzyme UBC9 and is sumolated in vivo.. J. Biol. Chem. 277: 30798 — 30804.  PubMed DOI:10.1074/jbc.M202780200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11744 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q92754 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]